Produits biochimiques et réactifs

<p>The cRaf antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and inhibit the activity of cRaf, a nuclear protein involved in various cellular processes. This antibody has been extensively studied and characterized for its ability to specifically bind to cRaf and prevent its interaction with other molecules.</p>

<p>Rabbit polyclonal USP44 antibody</p>

<p>NFS1 antibody was raised in Rabbit using Human NFS1 as the immunogen</p>

<p>Purified recombinant Human ETFB protein</p>

<p>FOXA2 antibody was raised in Mouse using a purified recombinant fragment of FOXA2 expressed in E. coli as the immunogen.</p>

<p>XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA</p>

<p>SULT1A1 antibody was raised using the N terminal of SULT1A1 corresponding to a region with amino acids ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GADD45A antibody, catalog no. 70R-10005</p>

<p>The Vinculin antibody is a low-molecular-weight growth factor that falls under the category of Life Sciences. It is a monoclonal antibody that has been specifically designed for immobilization purposes. This highly specialized antibody has the ability to bind with collagen and other binding proteins, making it an essential tool in various research applications. Additionally, the Vinculin antibody has shown neuroprotective properties and can neutralize vasoactive intestinal peptide (VIP), a hormone involved in regulating blood flow and immune responses. With its high affinity and specificity, this antibody can be used in experiments involving electrode-based techniques and interferon studies.</p>

<p>TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST</p>

Mouse PMN antibody was raised in rabbit using Mouse PMN as the immunogen.

<p>CSGALNACT2 antibody was raised in Rabbit using Human CSGALNACT2 as the immunogen</p>

<p>Purified Polyclonal ILF3 antibody</p>

<p>ACY3 antibody was raised in Rabbit using Human ACY3 as the immunogen</p>

Rabbit polyclonal RBM19 antibody

<p>MRPS16 antibody was raised in Rabbit using Human MRPS16 as the immunogen</p>

<p>The RHEB antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is used to detect and target RHEB, a protein involved in various cellular processes. This antibody has been extensively studied for its ability to inhibit the activity of RHEB, making it a valuable tool for research and therapeutic applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RGD1307041 antibody, catalog no. 70R-9487</p>

<p>PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids  STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL</p>

<p>The GIT1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to activated cytidine in order to facilitate various research applications. This antibody is commonly used in studies related to insulin, cytotoxicity, adeno-associated virus (AAV), autoantibodies, growth factors, and DNA aptamers. The GIT1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options that best suit their specific needs. With its ability to recognize and interact with specific targets, this antibody plays a crucial role in advancing scientific understanding and discovery.</p>

<p>Mouse monoclonal NRBP1 antibody</p>

<p>Purified recombinant CDK16 protein (His tag)</p>

<p>Mouse monoclonal ASCC1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNAI2 antibody, catalog no. 70R-5719</p>

<p>Karyopherin Alpha 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE</p>

<p>DLD antibody was raised in Rabbit using Human DLD as the immunogen</p>

<p>OPN1MW antibody was raised in rabbit using the C terminal of OPN1MW as the immunogen</p>

<p>VDBP antibody is a monoclonal antibody that specifically targets and binds to vitamin D binding proteins (VDBPs). It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. VDBP antibody has shown promising results in inhibiting the activity of tyrosine kinase receptors, which play a crucial role in cell growth and proliferation. By blocking these receptors, VDBP antibody can potentially halt the progression of certain types of cancer.</p>

<p>Purified recombinant Human RRM2 protein</p>

<p>Mouse monoclonal cJUN antibody</p>

<p>ZNF264 antibody was raised in rabbit using the N terminal of ZNF264 as the immunogen</p>

<p>The cMet antibody is a highly reactive monoclonal antibody that is used in various bioassays and research applications in the field of Life Sciences. It has been specifically designed to target and neutralize autoantibodies, which are antibodies that mistakenly attack healthy cells or tissues. This antibody has shown great potential in studying the role of cMet, a protein involved in cell signaling and growth regulation.</p>

<p>TNF protein is a highly viscous substance that is widely used in Life Sciences research. It is derived from adipose tissue and has the ability to neutralize the effects of tumor necrosis factor (TNF), a cytokine involved in inflammation and immune response. TNF protein contains numerous acidic residues that contribute to its high viscosity, making it ideal for immobilization studies and antibody conjugation. This protein also plays a crucial role in signal transduction pathways, acting as a protein kinase activator and modulating collagen synthesis. Additionally, TNF protein can be found in human serum and is sometimes used as a therapeutic protein drug for conditions such as rheumatoid arthritis. It has been shown to have antagonistic effects on interleukin-6 (IL-6), another pro-inflammatory cytokine.</p>

<p>Affinity purified Rabbit polyclonal GNAS antibody</p>

<p>Rabbit polyclonal HAND1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BCL2L12 antibody, catalog no. 70R-10366</p>

<p>CXCR4 antibody was raised in rabbit using the N terminal of CXCR4 as the immunogen</p>

<p>LRP2BP antibody was raised using the middle region of LRP2BP corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE</p>

<p>Rabbit polyclonal PFKM antibody</p>

<p>Rabbit anti-chicken IgG was raised in rabbit using chicken IgG F(ab')2 fragment as the immunogen.</p>

<p>Rabbit polyclonal SREBP1 antibody (Ser439)</p>

<p>JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE</p>

<p>Rabbit polyclonal RapGEF1 antibody</p>

<p>Rabbit polyclonal FGFR1/2 antibody (Tyr463/466)</p>

<p>DCLRE1C antibody was raised using a synthetic peptide corresponding to a region with amino acids SQSPKLFSDSDGESTHISSQNSSQSTHITEQGSQGWDSQSDTVLLSSQER</p>

<p>TUT1 antibody was raised in rabbit using the middle region of TUT1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal RGS10 antibody</p>

<p>Rabbit polyclonal EIF4A2 antibody (FITC)</p>

<p>The p53 antibody is a highly specialized monoclonal antibody designed to target and bind to the p53 protein. This protein plays a crucial role in regulating cell growth and preventing the formation of tumors. The p53 antibody is widely used in research and diagnostic applications, as it allows scientists to study the expression and function of p53 in various biological samples.</p>

<p>Factor X antibody was raised in sheep using human Factor X purified from plasma as the immunogen.</p>

<p>Rabbit polyclonal FUCA2 antibody (HRP)</p>

<p>ANKMY2 antibody was raised in Rabbit using Human ANKMY2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal SMC1B antibody</p>

<p>The SAA1 Antibody is a monoclonal antibody that plays a crucial role in endothelial growth. This antibody specifically targets and binds to histidine, a nuclear protein involved in various biological processes. In the field of Life Sciences, it has been extensively studied for its potential as an anti-HER2 antibody-drug conjugate, particularly in combination with trastuzumab. The SAA1 Antibody has shown promising results in inhibiting the growth factor signaling pathway, including epidermal growth factor (EGF) and activated HER2 receptors. With its high specificity and affinity, this antibody holds great potential for targeted therapies in the treatment of various diseases related to abnormal growth factor signaling.</p>

<p>The PDCD4 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein known as Programmed Cell Death 4 (PDCD4). This protein plays a crucial role in regulating various cellular processes, including cell growth, proliferation, and apoptosis.</p>

<p>FLRT3 protein is a glycosylated protein that plays a crucial role in various biological processes, including cell adhesion, migration, and angiogenesis. It is targeted by a monoclonal antibody that acts as a neutralizing agent. This monoclonal antibody specifically binds to FLRT3 protein and inhibits its interaction with other molecules such as oncostatin, TNF-α, interferon, and growth factors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM106C antibody, catalog no. 70R-6741</p>

<p>Purified recombinant TOR1A protein (His tag)</p>

<p>DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW</p>

<p>Rabbit polyclonal RFXAP antibody</p>

<p>The CDK4 antibody is a highly specialized antibody that has neuroprotective properties. It can be used in various research applications such as immunohistochemistry and electrode neutralization. This antibody specifically targets CDK4, a protein involved in cell cycle regulation and growth factor signaling. By binding to CDK4, this antibody can inhibit its activity and prevent the progression of certain diseases or conditions. The CDK4 antibody is available as both a monoclonal and polyclonal antibody, providing researchers with options depending on their specific needs. With its high specificity and affinity, this antibody is an essential tool in the field of life sciences for studying cellular processes and developing potential therapeutic interventions.</p>

<p>LRRTM1 antibody was raised in Rabbit using Human LRRTM1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35F1 antibody, catalog no. 70R-7103</p>

<p>The Ku80 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has been extensively studied and proven to have numerous applications in various fields. This antibody is particularly valuable for its ability to neutralize specific targets, including glutamate and TGF-beta, which are key molecules involved in various cellular processes.</p>

<p>CACNB1 antibody was raised using the C terminal of CACNB1 corresponding to a region with amino acids RTMATAALAASPAPVSNLQVQVLTSLRRNLGFWGGLESSQRGSVVPQEQE</p>

Rabbit polyclonal UBE4B antibody

<p>Rabbit polyclonal USP20 antibody</p>

<p>Mouse monoclonal PUS7 antibody</p>

<p>Mouse monoclonal Actin antibody</p>

<p>The HOXA1 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the HOXA1 protein, which plays a crucial role in embryonic development and cellular growth. This antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA assays.</p>

<p>The BMP10 antibody is a monoclonal antibody that targets β-catenin, a protein involved in cell signaling and development. It has been shown to neutralize the activity of BMP10, a growth factor that regulates various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has demonstrated its ability to inhibit the proliferation and migration of cells by disrupting the interaction between β-catenin and other proteins. Additionally, the BMP10 antibody has been found to induce apoptosis, or programmed cell death, through the fas-mediated pathway. Its cytotoxic effects make it a promising candidate for therapeutic applications in diseases such as cancer. Furthermore, this antibody has shown potential in inhibiting fibrinogen-induced platelet aggregation and reducing interleukin-6 production. Overall, the BMP10 antibody offers exciting possibilities for research and development in various fields related to cellular biology and disease treatment.</p>

<p>CIGB-300 is an anti-casein kinase 2 (CK2) peptide. CK2 is a serine-threonine protein kinase with more than 300 substrates which plays a role in several cellular processes including cell growth and proliferation, cell viability, and apoptosis. CK2 is also frequently dysregulated in many human tumours phosphorylation by CK2 is a biochemical event involved in human oncogenesis. CIGB-300 binds to the phospho-acceptor domain of CK2 substrates, impairing the correct phosphorylation by the enzyme, thus reducing tumour cell adhesion, migration and invasion. CIGB-300 therefore has potential as a cancer therapy. P15 is fused to the cell-penetrating peptide derived from the HIV-Tat protein that has been extensively used for delivering peptides cargoes within cells. P15-Tat induces apoptosis in a variety of tumour cell lines.</p>

<p>HFE antibody was raised in Rabbit using Human HFE as the immunogen</p>

<p>ARPC3 antibody was raised using the middle region of ARPC3 corresponding to a region with amino acids ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCT8 antibody, catalog no. 70R-3562</p>

<p>Rabbit polyclonal TNS3 antibody</p>

<p>Purified recombinant GINS4 protein</p>

<p>Rabbit polyclonal Chicken Serum Albumin antibody (FITC)</p>

<p>Purified recombinant ARL4A protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RASGRP2 antibody, catalog no. 70R-5804</p>

<p>Mouse monoclonal CALCOCO2 antibody</p>

<p>75-270 amino acids: MGSSHHHHHH SSGLVPRGSH MFDLVDYEEV LGKLGIYDAD GDGDFDVDDA KVLLGLKERS TSEPAVPPEE AEPHTEPEEQ VPVEAEPQNI EDEAKEQIQS LLHEMVHAEH ETEHSYHVEE TVSQDCNQDM EEMMSEQENP DSSEPVVEDE RLHHDTDDVT YQVYEEQAVY EPLENEGIEI TEVTAPPEDN PVEDSQVIVE EVSIFPVEEQ QEVPPDT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BTF3L3 antibody, catalog no. 70R-4384</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive human activity testing using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>The NSE antibody is a powerful tool in the field of Life Sciences. It is a growth factor that neutralizes cytotoxic effects and chemokines in various biological processes. This antibody specifically targets TGF-beta, a protein known for its role in cell growth and differentiation. The NSE antibody can be used in research and diagnostic applications to detect and measure the levels of TGF-beta in samples. Additionally, it has been used as a therapeutic agent, particularly in the treatment of collagen-related diseases and as an inhibitor of anti-ACTH antibodies. Its versatility makes it an essential component for scientists studying various cellular processes and diseases, including Mycoplasma genitalium infections. Trust the NSE antibody to provide accurate and reliable results for your research needs.</p>

<p>RPUSD3 antibody was raised using the middle region of RPUSD3 corresponding to a region with amino acids MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL</p>

<p>Rabbit polyclonal ZNF174 antibody</p>

<p>Rabbit polyclonal proBNP antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN1 antibody, catalog no. 70R-2230</p>

<p>Mouse monoclonal COX6A1 antibody</p>

<p>FLJ11730 antibody was raised using the N terminal Of Flj11730 corresponding to a region with amino acids HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM</p>

<p>CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD</p>

<p>The ASK1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody specifically designed to target and neutralize histidine, a key component involved in various biological processes. This antibody has shown great potential in research and therapeutic applications.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through a patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>1-170 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMEQ TEVLKPRTLA DLIRILHQLF AGDEVNVEEV QAIMEAYESD PTEWAMYAKF DQYRYTRNLV DQGNGKFNLM ILCWGEGHGS SIHDHTNSHC FLKMLQGNLK ETLFAWPDKK SNEMVKKSER VLRENQCAYI NDSVGLHRVE NISHTEPAVS LHLYSPPFDT CHAFDQR</p>

<p>UGT2A3 antibody was raised using the middle region of UGT2A3 corresponding to a region with amino acids GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR</p>

<p>APC2 antibody was raised in rabbit using the middle region of APC2 as the immunogen</p>

<p>NMBR antibody was raised using the N terminal of NMBR corresponding to a region with amino acids PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF641 antibody, catalog no. 70R-8421</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NET1 antibody, catalog no. 70R-3139</p>