Produits biochimiques et réactifs

A synthetic peptide for use as a blocking control in assays to test for specificity of PLCD1 antibody, catalog no. 70R-5852

Rabbit Polyclonal Tyrosine Hydroxylase antibody (Ser19)

Mouse monoclonal IL1a antibody (FITC)

CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG

A synthetic peptide for use as a blocking control in assays to test for specificity of Acd antibody, catalog no. 70R-8190

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF675 antibody, catalog no. 70R-9564

TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

A synthetic peptide for use as a blocking control in assays to test for specificity of CORIN antibody, catalog no. 70R-1759

GLA antibody was raised using the N terminal of GLA corresponding to a region with amino acids PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF

The E Cadherin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets E-cadherin, a protein involved in cell adhesion and cell signaling. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to have antiviral properties and can neutralize the activity of certain growth factors and chemokines. Additionally, the E Cadherin antibody has been used in studies involving granulosa cells and colony-stimulating factor. Its high specificity and affinity make it a valuable tool for researchers in the field of Life Sciences.

The IL3 antibody is a polyclonal antibody that is used for the immobilization of gm-csf, a colony-stimulating factor. It can be used in various applications such as ELISA and western blotting. The IL3 antibody has been shown to have high specificity and sensitivity when tested with human serum samples. It can also be used in conjunction with other antibodies, such as phalloidin, to study the effects of steroids on cell growth and differentiation. Additionally, monoclonal antibodies against tgf-β1 have been developed using flavobacterium heparinum as an immunogen. These antibodies have been shown to inhibit the cytotoxic effects of tgf-β1 and may have potential therapeutic applications in cancer treatment.

Affinity purified Rabbit polyclonal Calpain 5 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Hmx3 antibody, catalog no. 70R-8774

Rabbit polyclonal PLCG2 antibody (Tyr1217)

The AKT1 antibody is a highly specialized antibody that targets the AKT1 protein, which plays a crucial role in various cellular processes. This antibody specifically binds to the AKT1 protein and can be used in various research applications and assays. It has been shown to be effective in detecting and quantifying the levels of AKT1 protein in samples such as human serum or tissue lysates.

GLRA1 antibody was raised in rabbit using the middle region of GLRA1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RMI1 antibody, catalog no. 70R-5555

A synthetic peptide for use as a blocking control in assays to test for specificity of VSIG1 antibody, catalog no. 70R-7017

The SNAP25 antibody is a polyclonal antibody that specifically targets the protein kinase SNAP25. It is commonly used in life sciences research to study the function and regulation of this important protein. This antibody has been extensively tested and validated for various applications, including immunofluorescence, immunohistochemistry, and western blotting.

SYT1 antibody was raised in Mouse using a purified recombinant fragment of SYT1 expressed in E. coli as the immunogen.

Rabbit polyclonal TAS2R16 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD1 antibody, catalog no. 70R-9016

Factor IX antibody is a highly specialized polyclonal antibody that targets and neutralizes the activity of Factor IX, a crucial protein involved in blood clotting. This antibody is widely used in Life Sciences research and diagnostic applications. It has been extensively studied for its potential therapeutic use as an anti-her2 antibody, monoclonal antibody, and family kinase inhibitor. Factor IX antibody has also been shown to have an inhibitory effect on interferon, chemokine, and epidermal growth factor signaling pathways. Its high specificity and affinity make it an ideal tool for various immunoassays, including enzyme-linked immunosorbent assays (ELISA) and Western blotting. Additionally, this antibody can be conjugated with different molecules or labeled with spectrometric tags for advanced detection methods. With its lysine-specific binding properties, Factor IX antibody offers researchers a valuable resource for studying blood coagulation disorders and developing targeted therapies.

Affinity purified Rabbit polyclonal SENP2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PHYHIP antibody, catalog no. 70R-3248

His tag antibody was raised in rabbit using 6-His (HHHHHH) conjugated to KLH as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM80A antibody, catalog no. 70R-3797

Cytokeratin 20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.

The LOX antibody is a monoclonal antibody that targets the LOX protein, which plays a crucial role in various biological processes. This antibody can be used in Life Sciences research to study the function and expression of LOX. It is designed to specifically bind to LOX and can be used in techniques such as immunohistochemistry and Western blotting.

CHRFAM7A antibody was raised using the N terminal of CHRFAM7A corresponding to a region with amino acids QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC

The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.

The AP2M1 antibody is a highly specialized monoclonal antibody that targets the growth factor receptor AP2M1. It is colloidal in nature and has been specifically designed to bind to chemokines and antibodies, making it an essential tool in various life sciences research applications. The AP2M1 antibody has shown significant efficacy in studies involving breast cancer cell line MCF-7, where it demonstrated its ability to inhibit fatty acid uptake and disrupt intracellular trafficking of epidermal growth factor receptors. Additionally, this monoclonal antibody has been found to have potent anti-collagen activity and can be used for targeted therapy against diseases such as rheumatoid arthritis or fibrosis. Its activation potential on mesenchymal stem cells further highlights its versatility and potential applications in regenerative medicine.

OR2J2 antibody was raised in rabbit using the C terminal of OR2J2 as the immunogen

Rabbit polyclonal T4S1 antibody

The HSP90 beta antibody is an inducer used in assays to detect the presence of activated HSP90 beta. It specifically targets non-coding RNA and glycogen synthase kinase, inhibiting their activity. This antibody is widely used in Life Sciences research for its high-flux and accurate detection capabilities. Additionally, it has been shown to be effective in inhibiting the activity of sirtuins and lithium chloride. The HSP90 beta antibody can be used to extract specific proteins from samples and is commonly used as a serum marker in various applications. With its specificity and reliability, this antibody is a valuable tool for researchers in the field.

NAT10 antibody was raised in Rabbit using Human NAT10 as the immunogen