Produits biochimiques et réactifs

ATXN7L2 antibody was raised using the N terminal of ATXN7L2 corresponding to a region with amino acids KTSSREKGQGSRSRGHQPPEKTQKDNLCQPGGLTKDSPGKPPMAPPSKEP

MGC3207 antibody was raised in rabbit using the N terminal of MGC3207 as the immunogen

Purified Polyclonal GPRIN2 antibody

Rabbit polyclonal Gamma glutamyltransferase 4 antibody (Thr472)

FLJ44894 antibody was raised in rabbit using the N terminal of FLJ44894 as the immunogen

The FGF19 antibody is a polyclonal antibody that targets the growth factor FGF19. It is designed to specifically bind to FGF19 and can be used in various assays to detect and measure the levels of FGF19 in biological samples. The antibody is available as both monoclonal and chimeric polypeptides, offering flexibility in experimental design.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through rigorous testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

FTO antibody is a synthetic polyclonal antibody that targets the FTO protein. This protein plays a crucial role in various biological processes, including coagulation, tyrosine activation, and the regulation of gene expression. The FTO antibody is widely used in life sciences research to study the function and localization of FTO protein in different cell types and tissues. It can be used for techniques such as immunohistochemistry to visualize the distribution of FTO protein in tissue samples. Moreover, this antibody has been shown to inhibit the activity of FTO, making it a valuable tool for studying the effects of FTO inhibition on cellular processes. Researchers also use this antibody to investigate the role of FTO in diseases such as endotoxemia and explore its potential as a therapeutic target. With its high specificity and sensitivity, the FTO antibody is an essential tool for scientists working in various fields of biology and medicine.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique, which confirms its high frequency of human activity. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ13798 antibody, catalog no. 70R-7998

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB9B antibody, catalog no. 70R-9454

Thrombin antibody was raised in sheep using Thrombin prepared from purified rabbit Prothrombin as the immunogen.

The HSP27 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It has been extensively studied for its cytotoxic effects on human serum and its ability to neutralize the growth factor TGF-beta. This antibody specifically targets HSP27, a low-molecular-weight protein that plays a crucial role in cellular stress response and protection against apoptosis. The HSP27 antibody can be immobilized onto an electrode or used in conjunction with streptavidin for various research applications. Whether you are studying mesenchymal stem cells or investigating the signaling pathways involved in cell growth and differentiation, the HSP27 antibody is an invaluable tool for your experiments. Trust in its high specificity and reliability to deliver accurate results and advance your scientific discoveries.

TPD52 antibody was raised in rabbit using the C terminal of TPD52 as the immunogen

XAB2 antibody was raised in rabbit using the C terminal of XAB2 as the immunogen

alpha Actinin 4 antibody was raised using the N terminal of ACTN4 corresponding to a region with amino acids  LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA

A synthetic peptide for use as a blocking control in assays to test for specificity of STX4 antibody, catalog no. 70R-9805