Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.679 produits)
- Par Biological Target(100.185 produits)
- Par usage/effets pharmacologiques(6.848 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(355 produits)
- Biologie végétale(6.913 produits)
- Métabolites secondaires(14.362 produits)
130274 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
IRS1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for the bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been extensively studied using advanced techniques such as patch-clamp technique on human erythrocytes. The metabolization process involves various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their cell growth in culture.PTK2 antibody
PTK2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%TNIK antibody
TNIK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%RFP2 antibody
RFP2 antibody was raised in rabbit using the middle region of RFP2 as the immunogenDegré de pureté :Min. 95%SLC25A1 antibody
SLC25A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLDegré de pureté :Min. 95%ERBB3 antibody
The ERBB3 antibody is a monoclonal antibody that specifically targets the ERBB3 receptor. This receptor plays a crucial role in cell growth and survival pathways, making it an important target for therapeutic interventions. The ERBB3 antibody works by binding to the ERBB3 receptor and inhibiting its activity, thereby preventing the activation of downstream signaling pathways.Degré de pureté :Min. 95%ERMAP antibody
ERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNDegré de pureté :Min. 95%IL13RA2 antibody
The IL13RA2 antibody is a powerful tool used in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets the interleukin-13 receptor alpha 2 (IL13RA2). This antibody has shown high affinity and specificity for IL13RA2, making it an ideal choice for various research applications.Ataxin 2 antibody
The Ataxin 2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to annexin, a protein involved in various cellular processes. This buffered monoclonal antibody has been extensively tested and validated for its efficacy and specificity.
HNRPDL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPDL antibody, catalog no. 70R-1322
Degré de pureté :Min. 95%SREBP1 antibody
The SREBP1 antibody is a powerful tool used in life sciences research to study various aspects of cellular processes. It specifically targets the Sterol Regulatory Element-Binding Protein 1 (SREBP1), which plays a crucial role in lipid metabolism and the regulation of fatty acid synthesis.WDR35 antibody
WDR35 antibody was raised using the N terminal of WDR35 corresponding to a region with amino acids SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRSARL11 antibody
ARL11 antibody was raised using the middle region of ARL11 corresponding to a region with amino acids WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKLzts1 antibody
Lzts1 antibody was raised in rabbit using the C terminal of Lzts1 as the immunogenDegré de pureté :Min. 95%AKT1 protein
AKT1 protein is a reactive protein that plays a crucial role in various cellular processes. It is commonly used in Life Sciences research for its involvement in cell growth, proliferation, and survival. AKT1 protein can be utilized as a biomarker to study different diseases and conditions. It can be detected using techniques such as polymerase chain reaction (PCR) or monoclonal antibody-based assays. Additionally, AKT1 protein has been found to interact with other proteins, such as epidermal growth factor receptor (EGFR), through molecular docking studies. This interaction suggests its potential involvement in signaling pathways related to cell growth and development. Furthermore, AKT1 protein has been shown to exhibit hemolytic activity when exposed to certain conditions, making it an interesting target for further investigation in the field of Conjugated Proteins and Antigens research.Degré de pureté :Min. 95%Cytokeratin 5 antibody
Cytokeratin 5 antibody is a high-quality monoclonal antibody that specifically targets the apical membrane protein phosphatase. It plays a crucial role in regulating cell growth and differentiation by binding to tyrosine residues on epidermal growth factor receptors. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA assays.
TGF beta 2 antibody
The TGF beta 2 antibody is a monoclonal antibody that specifically targets and neutralizes the activity of TGF-beta 2, a growth factor involved in various biological processes. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the effects of TGF-beta 2 on cell proliferation, migration, and differentiation. It has also been found to have cytotoxic effects on certain cancer cells and can be used as a tool for studying the role of TGF-beta 2 in different disease models. Additionally, this antibody has been used in diagnostic applications to detect the presence of TGF-beta 2 in biological samples. With its high specificity and neutralizing properties, the TGF beta 2 antibody is a valuable tool for researchers studying growth factors, chemokines, and other signaling molecules involved in cellular processes.TMEFF1 antibody
TMEFF1 antibody was raised using the middle region of TMEFF1 corresponding to a region with amino acids YSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDDegré de pureté :Min. 95%Hemoglobin antibody
The Hemoglobin antibody is a powerful tool used in Life Sciences research. It specifically targets nuclear and epidermal growth factors, which play crucial roles in various biological processes. This antibody has been extensively studied for its potential applications in treating thrombocytopenia and blocking the activity of tumor necrosis factor-α (TNF-α), a potent pro-inflammatory cytokine. Additionally, it has shown cytotoxic effects against cancer cells by inhibiting the growth factors that promote their survival and proliferation. The Hemoglobin antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs. Its versatility makes it an invaluable asset in studying cell signaling pathways and developing targeted therapies.RHOA antibody
The RHOA antibody is a highly specialized biomolecule used in Life Sciences research. It specifically targets and binds to the activated form of RHOA, a small GTPase protein involved in various cellular processes. The antibody has been extensively studied and validated for its effectiveness in detecting RHOA activation.DKK3 antibody
The DKK3 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic and growth inhibitory properties. It functions by targeting and neutralizing the activity of DKK3, a phosphatase and growth factor involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the proliferation of cancer cells.Lipase antibody (Gastric)
Lipase antibody (Gastric) was raised using the N terminal of LIPF corresponding to a region with amino acids ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH
Degré de pureté :Min. 95%PRDM6 antibody
PRDM6 antibody was raised in rabbit using the N terminal of PRDM6 as the immunogenDegré de pureté :Min. 95%FBXO4 antibody
FBXO4 antibody was raised using the middle region of FBXO4 corresponding to a region with amino acids TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSKRabbit anti Dog IgG (H + L) (FITC)
Rabbit anti0dog IgG (H+L) (FITC) was raised in rabbit using canine IgG whole molecule as the immunogen.Degré de pureté :Min. 95%Factor XII antibody
Factor XII antibody was raised in goat using human Factor XII purified from plasma as the immunogen.Degré de pureté :Min. 95%SLC25A20 antibody
SLC25A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLDegré de pureté :Min. 95%Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 23-29 of cTnI as the immunogen.Arrestin B2 antibody
Arrestin B2 antibody was raised using the middle region of ARRB2 corresponding to a region with amino acids RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLGoat anti Rabbit IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Degré de pureté :Min. 95%ANP32E antibody
ANP32E antibody was raised using a synthetic peptide corresponding to a region with amino acids EDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDESMAD1 antibody
The SMAD1 antibody is a monoclonal antibody that targets the growth factor trastuzumab. This antibody specifically binds to the SMAD1 protein, which is involved in cell signaling pathways related to fibronectin and acidic environments. By binding to SMAD1, this antibody can inhibit its function and disrupt cellular processes that rely on its activity.Degré de pureté :Min. 95%Estrogen Sulfotransferase protein (His tag)
1-294 amino acids: MNSELDYYEK FEEVHGILMY KDFVKYWDNV EAFQARPDDL VIATYPKSGT TWVSEIVYMI YKEGDVEKCK EDVIFNRIPF LECRKENLMN GVKQLDEMNS PRIVKTHLPP ELLPASFWEK DCKIIYLCRN AKDVAVSFYY FFLMVAGHPN PGSLPEFVEK FMQGQVPYGS WYKHVKSWWE KGKSPRVLFL FYEDLKEDIR KEVIKLIHFL ERKPSEELVD RIIHHTSFQE MKNNPSTNYT TLPDEIMNQK LSPFMRKGIT GDWKNHFTVA LNEKFDKHYE QQMKESTLKF RTEILEHHHH HHDegré de pureté :Min. 95%CTLA4 antibody
CTLA4 antibody is a protein that targets the CTLA-4 receptor, which plays a crucial role in regulating immune responses. This antibody binds to CTLA-4 and blocks its interaction with B7 ligands, thereby enhancing T-cell activation and promoting anti-tumor immune responses. It has been shown to inhibit the growth of various types of tumors and is currently being used in cancer immunotherapy. Additionally, CTLA4 antibody has also been studied for its potential in treating autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. With its ability to modulate immune responses, this antibody holds great promise in the field of immunology and offers new avenues for therapeutic interventions.KIF9 antibody
KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQDegré de pureté :Min. 95%Psmc1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Psmc1 antibody, catalog no. 70R-9398Degré de pureté :Min. 95%RNF6 antibody
RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSELipoprotein (a) protein
Lipoprotein (a) protein is a versatile molecule that plays a crucial role in various biological processes. It acts as a mitogen-activated protein and interacts with other proteins such as anti-CD20 antibodies, albumin, collagen, and alpha-synuclein. This protein can be found in human serum and is involved in several important functions within the body.Degré de pureté :>95% Of Total Lipoprotein Content By ElectrophoresisRAPSN antibody
RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVScel antibody
Scel antibody was raised in rabbit using the C terminal of Scel as the immunogenDegré de pureté :Min. 95%Ferritin protein
Ferritin protein is a multifunctional protein that plays a crucial role in iron homeostasis. It acts as a storage form for iron in the body, preventing oxidative damage caused by excess iron. Ferritin also serves as a diagnostic agent for assessing iron levels in the body and is used in various research fields within Life Sciences. One of the key functions of ferritin is its ability to bind and store iron ions. This helps regulate iron levels in the body, ensuring that it is available when needed for essential processes such as hemoglobin synthesis. Additionally, ferritin has been found to interact with other molecules and proteins, including fibrinogen and hepatocyte growth factor, contributing to various biological functions. The use of monoclonal antibodies specific to ferritin has enabled researchers to study its expression and localization within cells. This has provided valuable insights into its role in cellular processes such as growth factor signaling and response to oxidative stress. Furthermore, ferritin has been implicated in various diseases and conditions. ForDegré de pureté :>95% By Sds-PageBRS3 antibody
The BRS3 antibody is a nuclear antibody that is used in Life Sciences for various applications. It can be used as a test compound or inhibitor in research studies. This antibody specifically targets BRS3, a receptor protein involved in various physiological processes. The BRS3 antibody is highly specific and has been solubilized for easy use in different assays. It can be used as an affinity ligand to isolate and purify BRS3 or as a tool to detect the presence of BRS3 in samples. This polyclonal antibody is produced using advanced techniques and has been validated for its performance and reliability. Whether you are studying autoantibodies or investigating the role of BRS3 in diseases, the BRS3 antibody is an essential tool for your research needs.TOLLIP antibody
The TOLLIP antibody is a highly specialized solution used in the field of Life Sciences. It is designed to target and react with Toll-interacting protein (TOLLIP), an important protein involved in various cellular processes. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs.KCNK15 antibody
KCNK15 antibody was raised using the middle region of KCNK15 corresponding to a region with amino acids ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSIDegré de pureté :Min. 95%C1QB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C1QB antibody, catalog no. 70R-5985Degré de pureté :Min. 95%UBE2C antibody
UBE2C antibody was raised using the middle region of UBE2C corresponding to a region with amino acids GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQDegré de pureté :Min. 95%TRAFD1 antibody
TRAFD1 antibody was raised in rabbit using the C terminal of TRAFD1 as the immunogenDegré de pureté :Min. 95%TCTA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TCTA antibody, catalog no. 70R-6740Degré de pureté :Min. 95%SLC22A7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A7 antibody, catalog no. 70R-7526Degré de pureté :Min. 95%DGKA antibody
The DGKA antibody is a specific antibody that targets the epidermal growth factor (EGF) and has applications in Life Sciences. It is a monoclonal antibody that can neutralize the effects of TNF-α, which is involved in inflammation and immune response. The DGKA antibody has been shown to inhibit the activity of collagen, TGF-beta, and other EGF-like proteins, which play key roles in cell growth and tissue repair. Additionally, it can bind to fibronectin and block its interactions with other molecules. This antibody is highly effective in blocking the activity of autoantibodies and growth factors, making it a valuable tool for research in various fields such as immunology, oncology, and regenerative medicine. With its ability to target activated chemokines, the DGKA antibody holds great potential for therapeutic applications as well.
