Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.674 produits)
- Par Biological Target(100.192 produits)
- Par usage/effets pharmacologiques(6.848 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(355 produits)
- Biologie végétale(6.913 produits)
- Métabolites secondaires(14.362 produits)
130274 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Sox2 antibody
Sox2 antibody was raised in rabbit using residues 113-127 [KEHPDYKYRPRRKTK] of the 37 kDa human Sox2 protein as the immunogen.Degré de pureté :Min. 95%H pylori, cagA protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.Degré de pureté :Min. 95%COX10 antibody
COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGLDegré de pureté :Min. 95%FGF1 antibody
The FGF1 antibody is a monoclonal antibody that specifically targets the HER2 protein. It belongs to the class of anti-HER2 antibodies, which also includes adalimumab and trastuzumab. This antibody binds to HER2, preventing its interaction with other biomolecules and inhibiting downstream signaling pathways involved in cell growth and division.
Vimentin antibody
The Vimentin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and detect vimentin, an intermediate filament protein that plays a crucial role in maintaining cell structure and integrity. This antibody is particularly useful in research related to amyloid plaque formation, as it can identify activated vimentin in these structures.ALDH1L1 antibody
The ALDH1L1 antibody is a highly reactive collagen-specific antibody that is commonly used in the field of Life Sciences. This monoclonal antibody has been specifically designed to target and bind to the activated form of collagen, which is a key component of various biological processes. It can be used for applications such as immobilization and detection of collagen in samples, as well as for studying the role of collagen in different cellular pathways.XRCC5 antibody
The XRCC5 antibody is a polyclonal antibody that is used in various applications in the field of Life Sciences. This antibody is specifically designed to target XRCC5, which is an important protein involved in DNA repair and recombination. The XRCC5 antibody can be used for immobilization on electrodes, making it useful in techniques such as electrochemical immunoassays. Additionally, this antibody has been shown to be effective in detecting hormone peptides, including anti-HBs and c-myc, in human serum samples. It can also be used to study the serotonergic system and investigate the role of XRCC5 in fatty acid metabolism. With its broad range of applications, the XRCC5 antibody is a valuable tool for researchers working in various fields of study within Life Sciences.AKT2 antibody
AKT2 antibody was raised in rabbit using the middle region of AKT2 as the immunogenDegré de pureté :Min. 95%SERPINI1 antibody
SERPINI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFDegré de pureté :Min. 95%BMX-IN-1
CAS :BMX-IN-1 is a DNA polymerase inhibitor that has been used in the study of chemical biology. It has been shown to selectively inhibit transcription and replication of pro-inflammatory cytokines, such as tumor necrosis factor-α (TNF-α). The kinetics of BMX-IN-1 have been studied by measuring the inhibition of transcription in vitro. The optimum concentration for BMX-IN-1 was found to be 0.3 μM, which inhibits the synthesis of TNF-α by 58%. BMX-IN-1 also inhibits cancer tissue growth and may be an effective treatment for cancer. This drug is a potential molecular target for cervical cancer.
Formule :C29H24N4O4SDegré de pureté :Min. 95%Masse moléculaire :524.59 g/molalpha Tubulin 4A antibody
alpha Tubulin 4A antibody was raised using the middle region of TUBA4A corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHWNT7B antibody
WNT7B antibody was raised using the middle region of WNT7B corresponding to a region with amino acids WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMDegré de pureté :Min. 95%B3GAT3 antibody
B3GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTYDegré de pureté :Min. 95%RACGAP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been confirmed through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth. With its multifaceted mechanism of action and proven efficacy, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an invaluable tool in the fight against tuberculosis.Transferrin protein
Transferrin protein is a versatile monoclonal antibody that has various applications in the field of life sciences. It plays a crucial role in cell growth and development by binding to specific molecules and promoting cellular processes. Transferrin protein is commonly used as a carrier for targeted drug delivery, especially in combination with trastuzumab, an anti-HER2 antibody. The protein contains an amino group that can be conjugated with different molecules, such as fatty acids or other monoclonal antibodies, to enhance its functionality.
Degré de pureté :Min. 95%CCNB1IP1 antibody
CCNB1IP1 antibody was raised in mouse using recombinant Human Cyclin B1 Interacting Protein 1 (Ccnb1Ip1)PDGFRalpha kinase inhibitor 1
CAS :Produit contrôléPDGFRalpha kinase inhibitor 1 is an inhibitor of the PDGFRalpha protein. The PDGFRalpha protein is a receptor tyrosine kinase that belongs to the group of receptors that are activated by specific growth factors and cytokines. This inhibitor has affinity for the active site of PDGFRalpha, where it binds and blocks the catalytic activity of this enzyme.
PDGFRalpha kinase inhibitor 1 is a potent, selective and reversible inhibitor of PDGFRα with IC50 value in low micromolar range. It does not inhibit other tyrosine kinases such as PDGFRA, AXL, RET or KIT.Formule :C34H34N8O2Degré de pureté :Min. 95%Masse moléculaire :586.7 g/molOxycodone antibody
Oxycodone antibody was raised in mouse using oxycodone-BSA as the immunogen.Degré de pureté :Min. 95%HCK antibody
The HCK antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the HCK protein, which is found in human hepatocytes. This antibody has been shown to have cytotoxic effects on cells expressing high levels of HCK. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. The HCK antibody can also be immobilized on an electrode for use in biosensor applications. In addition, this antibody has been used in studies investigating the role of interferon and CXCR4 binding proteins in cell signaling pathways. Its binding properties are highly specific to the acidic chemokine receptors expressed on human serum.MDL-29951
CAS :Please enquire for more information about MDL-29951 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C12H9Cl2NO4Degré de pureté :Min. 95%Masse moléculaire :302.11 g/molPDGF BB antibody
PDGF BB antibody was raised in rabbit using highly pure recombinant human PDGF-BB as the immunogen.Degré de pureté :Min. 95%Myeloperoxidase antibody
Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.TRAPPC6B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC6B antibody, catalog no. 70R-3155Degré de pureté :Min. 95%OXCT2 antibody
OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
Degré de pureté :Min. 95%SCGB1A1 antibody
SCGB1A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLPQKPRESIIKLMEKIADegré de pureté :Min. 95%AID antibody
The AID antibody is a highly specialized monoclonal antibody that targets the adeno-associated virus (AAV). It specifically binds to insulin and has cytotoxic properties, making it effective in the treatment of insulin-related disorders. The AID antibody works by inhibiting the activity of reactive 3-kinase, an enzyme involved in insulin signaling pathways. This inhibition leads to a decrease in insulin production and secretion, ultimately resulting in improved glucose control. Additionally, the AID antibody can be used as a diagnostic tool for detecting autoantibodies against insulin in patients with autoimmune diseases such as type 1 diabetes. With its high specificity and affinity for insulin, the AID antibody offers promising potential in the field of Life Sciences and holds great promise for therapeutic applications.
HSFY1 antibody
HSFY1 antibody was raised in rabbit using the middle region of HSFY1 as the immunogenDegré de pureté :Min. 95%DAGLB antibody
DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGSDegré de pureté :Min. 95%MCL1 antibody
The MCL1 antibody is a monoclonal antibody that targets the MCL1 protein. This protein is involved in cell survival and has been implicated in various diseases, including cancer. The MCL1 antibody specifically binds to the MCL1 protein, preventing its interaction with other proteins and inhibiting its function. This can lead to decreased cell survival and increased sensitivity to chemotherapy or other treatments. Additionally, the MCL1 antibody has been shown to have anti-inflammatory properties and may play a role in immune regulation. Overall, the MCL1 antibody is a valuable tool for researchers in the field of life sciences and has potential applications in cancer treatment and other therapeutic interventions.MST1R antibody
MST1R antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%RBMS2 antibody
RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGNCYP2A6 antibody
CYP2A6 antibody was raised in rabbit using purified, histidine-tagged, full length human P450 2A6 fusion protein as the immunogen.Degré de pureté :Min. 95%PDE2A antibody
PDE2A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%DNAJB12 antibody
DNAJB12 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSDegré de pureté :Min. 95%SIRPG antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections. With its bactericidal activity, this compound effectively inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.OR2J2 antibody
OR2J2 antibody was raised in rabbit using the C terminal of OR2J2 as the immunogen
Degré de pureté :Min. 95%TAB2 antibody
TAB2 antibody was raised in Mouse using a purified recombinant fragment of human TAB2 expressed in E. coli as the immunogen.Ferritin antibody
Ferritin antibody was raised in rabbit using Ferritin [human Spleen] as the immunogen.Degré de pureté :Min. 95%AF594 Donkey anti Goat IgG (H + L)
Donkey anti Goat IgG (Heavy + Light chain) secondary antibody with AF594 photostable fluorescent dye label. Minimal cross-reaction with Human, Mouse, Chicken, Rabbit, Guniea Pig, Syrian Hamster, Horse, Rat. Lyophilized from 0.01M Na3PO4, 0.25M NaCl, pH 7.6, with 15mg/ml BSA, and 0.05% NaN3. Reconstitute with 0.4 ml of distilled Water.Degré de pureté :Min. 95%ZDHHC24 antibody
ZDHHC24 antibody was raised using the middle region of ZDHHC24 corresponding to a region with amino acids QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTADegré de pureté :Min. 95%STYK1 antibody
STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIDegré de pureté :Min. 95%ELOVL7 antibody
ELOVL7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSHaptoglobin antibody
Haptoglobin antibody was raised using the middle region of HP corresponding to a region with amino acids NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEDegré de pureté :Min. 95%Aprotinin antibody
The Aprotinin antibody is a monoclonal antibody that targets the glycopeptide Aprotinin. This antibody has been shown to have a significant impact on various aspects of Life Sciences research. It has been found to inhibit the expression of E-cadherin, a protein involved in cell adhesion and migration. Additionally, the Aprotinin antibody has been used in studies investigating the role of interferon in adipose tissue and adipocyte function. It has also been utilized as a tool for studying insulin signaling and inhibitors of fatty acid metabolism. With its wide range of applications, this Aprotinin antibody is an essential tool for researchers in the field of Life Sciences.DUX3 antibody
DUX3 antibody was raised in rabbit using the N terminal of DUX3 as the immunogenDegré de pureté :Min. 95%SP110 antibody
The SP110 antibody is a monoclonal antibody that specifically targets the SP110 protein. This protein is involved in various cellular processes, including fibrinogen metabolism and regulation of mesenchymal stem cells. The SP110 antibody has been shown to have cytotoxic effects on cancer cells by activating caspase-9, a key enzyme involved in apoptosis. Additionally, this antibody can inhibit the activity of certain kinases, making it a potential therapeutic option for diseases related to kinase dysregulation. The SP110 antibody is widely used in life sciences research and has applications in fields such as immunology and oncology. It offers researchers a valuable tool for studying the function and regulation of the SP110 protein and its involvement in various biological pathways.C13ORF7 antibody
C13ORF7 antibody was raised using the N terminal Of C13Orf7 corresponding to a region with amino acids LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG
CD80 antibody
The CD80 antibody is a growth factor that consists of acid residues. It belongs to the class of antibodies and specifically targets TGF-beta. This monoclonal antibody can be used in various applications in the Life Sciences field. It has been shown to neutralize the activity of CD80, which is involved in the regulation of immune responses. The CD80 antibody can be used in experiments involving transferrin or streptavidin as it binds specifically to these molecules. Additionally, it has been shown to have a trifunctional effect on mesenchymal stem cells, including promoting their proliferation, differentiation, and migration. This monoclonal antibody is highly specific and exhibits high affinity for its target molecule. Researchers can use the CD80 antibody as a valuable tool in their studies focused on understanding immune responses and developing therapeutic inhibitors.ARV1 antibody
ARV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQDDegré de pureté :Min. 95%IL16 antibody
IL16 antibody was raised in rabbit using highly pure recombinant hIL-16 as the immunogen.Degré de pureté :Min. 95%SULT1B1 antibody
SULT1B1 antibody was raised using the N terminal of SULT1B1 corresponding to a region with amino acids MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGPREP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PREP antibody, catalog no. 70R-4323
Degré de pureté :Min. 95%CD5 antibody
CD5 antibody is a monoclonal antibody that targets CD5, a protein expressed on the surface of certain cells, including MDA-MB-231 breast cancer cells. This antibody can be used in various life science applications, such as cell-based assays and immunohistochemistry. CD5 antibody has been shown to have cytotoxic effects on cancer cells and may be useful in combination with other anti-cancer drugs. Additionally, this antibody can be used in studies involving cardiac muscle troponin and glucagon. Its specificity and effectiveness make it a valuable tool for researchers in the field of molecular biology and drug discovery.STAT2 antibody
The STAT2 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the STAT2 protein, which plays a crucial role in signal transduction and immune response. This antibody can be used to study various cellular processes such as growth factor signaling, fatty acid metabolism, and phosphatase activity. The STAT2 antibody is highly specific and has been validated for use in different applications including Western blotting, immunohistochemistry, and immunofluorescence. It is produced using state-of-the-art techniques to ensure high quality and reliability. Additionally, this antibody has been purified using serum albumin-binding cellulose columns to eliminate any non-specific binding. Trust the STAT2 antibody for accurate and reproducible results in your research experiments.Human Growth Hormone (> 95% pure)
Purified native Human Human Growth Hormone (> 95% pure)Degré de pureté :Purity ≥95% By Sds-Page
