Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.621 produits)
- Par Biological Target(100.478 produits)
- Par usage/effets pharmacologiques(6.929 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(353 produits)
- Biologie végétale(6.913 produits)
- Métabolites secondaires(14.365 produits)
130328 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
DLK1 antibody
The DLK1 antibody is a highly specific polyclonal antibody that binds to the antigen binding domain of the CB2 receptor. It is used in life sciences research to detect and study cell antigens and human enzymes. This antibody is produced using advanced techniques and has been validated for its high specificity and sensitivity. It can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. The DLK1 antibody is an essential tool for researchers working with biomolecules and studying specific antibodies. Its high affinity and specificity make it ideal for detecting and quantifying target proteins in biological samples. With its ability to bind to actin filaments, this antibody can provide valuable insights into cellular processes and signaling pathways.Degré de pureté :Min. 95%SLC22A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A1 antibody, catalog no. 70R-1736Degré de pureté :Min. 95%BNP antibody
BNP antibody was raised in Mouse using synthetic peptide corresponding to aa (Gly-Leu-Gln-Glu-Gln-Arg-Asn-His-Leu-Gln-Gly-Lys-Leu-Cys) of human BNP, conjugated to KLH as the immunogen.Caveolin 1 antibody
The Caveolin 1 antibody is a powerful tool in the field of life sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody has been extensively studied and proven to be effective in various applications.FASTKD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FASTKD2 antibody, catalog no. 70R-3176Degré de pureté :Min. 95%LMP2 (236-244) , RRR
Custom research peptide; min purity 95%.
Formule :C56H99N25O11Degré de pureté :Min. 95%Masse moléculaire :1,298.5 g/molGIP (3-42), human
Custom research peptide; min purity 95%.Formule :C214H324N58O63SDegré de pureté :Min. 95%Masse moléculaire :4,749.38 g/molTIMP1 antibody
TIMP1 antibody was raised in mouse using purified bovine dental pulp TIMP-1 as the immunogen.PH4 antibody
PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGGDegré de pureté :Min. 95%Prion Peptide (106-126), Human
CAS :Custom research peptide; min purity 95%.Formule :C80H138N26O24S2Degré de pureté :Min. 95%Masse moléculaire :1,912.28 g/molBMP4 antibody
BMP4 antibody was raised in mouse using recombinant mouse bone morphogenetic Protein 4 (BMP-4) as the immunogen.HMBS antibody
HMBS antibody was raised using the middle region of HMBS corresponding to a region with amino acids SSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQR
DPH4 antibody
DPH4 antibody was raised using the N terminal Of Dph4 corresponding to a region with amino acids MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGSLC5A9 antibody
SLC5A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIADegré de pureté :Min. 95%PF 06260933 dihydrochloride
CAS :PF 06260933 is a small-molecule that induces apoptosis in glioma cells by targeting mitogen-activated protein kinase (MAPK) and inhibiting the tumor suppressor gene p53. PF 06260933 binds to and inhibits MAPK, preventing the activation of downstream signaling proteins. PF 06260933 activates a process called large-scale genomic reorganization, which leads to cancer cell death. It is being investigated for the treatment of glioblastoma and other brain tumors. The drug has been shown to be effective in patients with malignant gliomas who have progressed on standard therapies.Formule :C16H15Cl3N4Degré de pureté :Min. 95%Masse moléculaire :369.7 g/molHBV core14, (HBA31)
Custom research peptide; min purity 95%.Formule :C53H95N17O18Degré de pureté :Min. 95%Masse moléculaire :1,258.45 g/molCHI3L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHI3L1 antibody, catalog no. 70R-5358Degré de pureté :Min. 95%UPF2 antibody
UPF2 antibody was raised in rabbit using the N terminal of UPF2 as the immunogenDegré de pureté :Min. 95%α-Defensin-1, human
CAS :Custom research peptide; min purity 95%.Formule :C167H256N48O50S6Degré de pureté :Min. 95%Masse moléculaire :3,928.58 g/molTAAR1 antibody
TAAR1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%SEQ ID NO:549
Custom research peptide; min purity 95%.Formule :C63H91N13O13Degré de pureté :Min. 95%Masse moléculaire :1,238.51 g/molIKB alpha antibody
The IKB alpha antibody is a highly effective monoclonal antibody that has neutralizing properties. It specifically targets and binds to IKB alpha, a protein involved in the regulation of various cellular processes. This antibody is capable of inhibiting the activity of transforming growth factor-beta (TGF-beta), tumor necrosis factor-alpha (TNF-alpha), and interferon, which are all important signaling molecules involved in immune responses and inflammation.MSL3L2 antibody
MSL3L2 antibody was raised in rabbit using the middle region of MSL3L2 as the immunogenDegré de pureté :Min. 95%CD14 protein
CD14 protein is a cytotoxic protein that plays a crucial role in the immune response. It acts as a receptor for lipopolysaccharides (LPS), which are found on the surface of bacteria. CD14 protein binds to LPS and initiates an immune response by activating various signaling pathways, leading to the production of inflammatory cytokines such as tumor necrosis factor-alpha (TNF-α). This protein is widely used in Life Sciences research for its inhibitory factor properties.Degré de pureté :Min. 95%Chk1 antibody
The Chk1 antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets fibrinogen, an activated protein involved in blood clotting. This antibody has been extensively studied and proven to have neutralizing effects on tumor necrosis factor-α (TNF-α), a potent inflammatory cytokine. Additionally, it has shown promising results as an anti-her2 antibody, inhibiting the growth of cancer cells that overexpress the epidermal growth factor receptor. The Chk1 antibody also exhibits inhibitory effects on endothelial growth factors, making it a potential therapeutic option for angiogenesis-related disorders. With its diverse range of applications and proven efficacy, this antibody is a valuable tool for researchers and clinicians alike.CBP antibody
The CBP antibody is a highly effective inhibitor that targets nuclear proteins. It is a monoclonal antibody that specifically recognizes and binds to acetylated biomolecules. This antibody has been extensively studied and proven to be cytotoxic against various types of cells. In Life Sciences research, the CBP antibody is commonly used in reaction solutions for experiments involving brain natriuretic peptide (BNP) and other related growth factors. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. The CBP antibody is supplied in buffered solutions, ensuring stability and maintaining its effectiveness throughout experiments.
RSRC2 antibody
RSRC2 antibody was raised using the C terminal of RSRC2 corresponding to a region with amino acids DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARSIL20R2 antibody
The IL20R2 antibody is a monoclonal antibody that is used in immunoassays to detect and quantify IL20R2 protein levels in human serum. It has been shown to have high specificity and sensitivity, making it an ideal tool for researchers studying the role of IL20R2 in various biological processes. This antibody can be used for applications such as Western blotting, ELISA, and immunohistochemistry. The IL20R2 antibody has also been used in molecular docking studies to understand its interaction with other molecules, providing valuable insights into its mechanism of action. With its ultrasensitive detection capabilities, this antibody is a valuable asset in the field of life sciences research.SLAIN1 antibody
SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPSCanine Parvovirus protein
Canine Parvovirus protein is a vital component in the field of Life Sciences. It is an electrode that is used to detect the presence of virus surface antigens. This protein is commonly used in Proteins and Antigens research, where it serves as a target molecule for monoclonal antibodies. These monoclonal antibodies are specifically designed to bind with the Canine Parvovirus protein, allowing for its immobilization and subsequent analysis using spectrometric or mass spectrometric methods.Degré de pureté :Min. 95%EGFR-derived peptide
Custom research peptide; min purity 95%.Formule :C69H114N18O24Degré de pureté :Min. 95%Masse moléculaire :1,579.78 g/molPCGF6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PCGF6 antibody, catalog no. 70R-2762Degré de pureté :Min. 95%[Phe1,Ser2,Tyr6]-PAR-1 (1-6) amide (human)
Custom research peptide; min purity 95%.Formule :C39H60N10O8Degré de pureté :Min. 95%Masse moléculaire :796.98 g/molCYP2A7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2A7 antibody, catalog no. 70R-7502Degré de pureté :Min. 95%EVI1 antibody
EVI1 antibody was raised in mouse using recombinant Human Ecotropic Viral Integration Site 1 (Evi1)
CARM1 antibody
The CARM1 antibody is a highly specific and potent inhibitor of CARM1 (Coactivator-associated arginine methyltransferase 1), an enzyme that plays a crucial role in gene regulation. This antibody is isolated from retinal cells and is widely used in Life Sciences research as a tool to study the function of CARM1. It is commonly used as a primary antibody in various applications, such as immunohistochemistry, immunofluorescence, and Western blotting.Degré de pureté :Min. 95%CLEC4M antibody
CLEC4M antibody was raised using the N terminal of CLEC4M corresponding to a region with amino acids MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGADegré de pureté :Min. 95%Substance P-Gly-Lys-Arg
Custom research peptide; min purity 95%.
Formule :C77H124N24O17SDegré de pureté :Min. 95%Masse moléculaire :1,690.06 g/molRER1 antibody
RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFDegré de pureté :Min. 95%Bradykinin [Des-Arg1]
Custom research peptide; min purity 95%.Formule :C44H61N11O10Degré de pureté :Min. 95%Masse moléculaire :904.04 g/molSEMA6A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SEMA6A antibody, catalog no. 70R-7134Degré de pureté :Min. 95%WNK1 antibody
WNK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%CAMLG antibody
CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVLTA4H protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism, this drug binds to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has demonstrated its high efficacy using advanced techniques like the patch-clamp technique on human erythrocytes.Degré de pureté :Min. 95%Scg3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Scg3 antibody, catalog no. 70R-9776Degré de pureté :Min. 95%PRKCZ antibody
PRKCZ antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%PSCA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
AHR antibody
AHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%TNFR2 antibody
TNFR2 antibody is a monoclonal antibody that specifically targets the tumor necrosis factor receptor 2 (TNFR2). It has been widely used in life sciences research to study the role of TNFR2 in various biological processes. This antibody binds to the amino-terminal region of TNFR2 and can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting. TNFR2 antibody has been shown to have inhibitory effects on the activation of cardiomyocytes and the production of chemokines. It can also neutralize the activity of TNF-α, a pro-inflammatory cytokine. Additionally, this antibody has been used in studies investigating the natriuretic and anti-apoptotic effects of TNFR2 signaling. With its high specificity and affinity, TNFR2 antibody is a valuable tool for researchers studying TNFR2-related pathways and functions.ZNF778 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF778 antibody, catalog no. 70R-8167Degré de pureté :Min. 95%Rabbit anti Sheep IgG (Alk Phos)
Rabbit anti-sheep IgG (Alk Phos) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.Degré de pureté :Min. 95%W-K-Y-M-V-M-NH2
Custom research peptide; min purity 95%.Formule :C41H61N9O7S2Degré de pureté :Min. 95%Masse moléculaire :856.13 g/molTetraspanin 2 antibody
Tetraspanin 2 antibody was raised using the middle region of TSPAN2 corresponding to a region with amino acids FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSDegré de pureté :Min. 95%TDRD9 antibody
TDRD9 antibody was raised using the middle region of TDRD9 corresponding to a region with amino acids AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPMHBcAg (HBV) (18-27)
Custom research peptide; min purity 95%.
Formule :C580H78N10O15Degré de pureté :Min. 95%Masse moléculaire :1,155.33 g/molHER2/neu(654-662) GP2
Custom research peptide; min purity 95%.
Formule :C42H77N9O11Degré de pureté :Min. 95%Masse moléculaire :884.12 g/molActivity-Dependent Neurotrophic Factor, ADNF
Custom research peptide; min purity 95%.Formule :C41H74N12O12Degré de pureté :Min. 95%Masse moléculaire :927.12 g/molβ-MSH, human
CAS :Custom research peptide; min purity 95%.
Formule :C118H174N34O35SDegré de pureté :Min. 95%Masse moléculaire :2,660.9 g/molPACAP-27 (human, mouse, ovine, porcine, rat)
CAS :Custom research peptide; min purity 95%.
Formule :C142H224N40O39SDegré de pureté :Min. 95%Masse moléculaire :3,147.68 g/molEXO1 antibody
The EXO1 antibody is a highly specific and sensitive polyclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to detect and target a variety of proteins, making it an essential tool in many research applications. This antibody has been extensively tested and validated, ensuring reliable and accurate results.
TNF alpha antibody
The TNF alpha antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a key player in inflammation and immune response. By binding to TNF-α, this antibody inhibits its activity, preventing it from interacting with its receptors and triggering inflammatory responses.LDB3 antibody
LDB3 antibody was raised using the N terminal of LDB3 corresponding to a region with amino acids PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPSHemoglobin antibody
The Hemoglobin antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and binds to hemoglobin, a protein found in red blood cells that carries oxygen throughout the body. By binding to hemoglobin, this antibody can be used to study its function and regulation.Influenza A NP (366-374) Strain A/NT/60/68
Custom research peptide; min purity 95%.
Formule :C36H59N11O17S2Degré de pureté :Min. 95%Masse moléculaire :982.06 g/molVAChT antibody
VAChT antibody was raised in guinea pig using synthetic peptide from the C-terminus of rat VAChT conjugated to BSA as the immunogen.Degré de pureté :Min. 95%Human IgG2 protein
Human IgG2 protein is a monoclonal antibody that plays a crucial role in the immune system. It specifically targets autoantibodies and inhibits their harmful effects on the body. This protein has been extensively studied in the field of Life Sciences for its ability to neutralize chemokines and other factors involved in inflammatory processes. Human IgG2 also interacts with annexin A2, a protein involved in cardiomyocyte function, and has been shown to have natriuretic properties.Degré de pureté :>96% Pure By Sds-PagePKN1 antibody
The PKN1 antibody is a cell proliferation inhibitory agent that belongs to the group of Polyclonal Antibodies. It has been shown to inhibit the growth of lymphocytic choriomeningitis by blocking the action of chemokines. This antibody can be used in vitro assays to study the effects of PKN1 on cell proliferation and migration. The PKN1 antibody is available as a monoclonal antibody, which means it specifically targets and neutralizes the PKN1 protein. It can be delivered using various methods, including the emulsion-solvent evaporation method. In addition to its cell growth inhibitory properties, this antibody also exhibits an antiangiogenic effect by blocking the growth of blood vessels. The PKN1 antibody is widely used in research laboratories and life sciences industries for its potential as a therapeutic medicament.TEC antibody
TEC antibody was raised in Mouse using a purified recombinant fragment of TEC expressed in E. coli as the immunogen.
![[Phe1,Ser2,Tyr6]-PAR-1 (1-6) amide (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP16885.webp&w=3840&q=75)
![Bradykinin [Des-Arg1]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPB16924.webp&w=3840&q=75)
