Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.574 produits)
- Par Biological Target(100.726 produits)
- Par usage/effets pharmacologiques(6.937 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(439 produits)
- Biologie végétale(6.907 produits)
- Métabolites secondaires(14.367 produits)
130493 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
TMEM144 antibody
TMEM144 antibody was raised using the middle region of TMEM144 corresponding to a region with amino acids LSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDLDegré de pureté :Min. 95%ZNF618 antibody
ZNF618 antibody was raised in rabbit using the N terminal of ZNF618 as the immunogenDegré de pureté :Min. 95%CLIC1 protein (His tag)
1-241 amino acids: MGSSHHHHHH SSGLVPRGSH MAEEQPQVEL FVKAGSDGAK IGNCPFSQRL FMVLWLKGVT FNVTTVDTKR RTETVQKLCP GGQLPFLLYG TEVHTDTNKI EEFLEAVLCP PRYPKLAALN PESNTAGLDI FAKFSAYIKN SNPALNDNLE KGLLKALKVL DNYLTSPLPE EVDETSAEDE GVSQRKFLDG NELTLADCNL LPKLHIVQVV CKKYRGFTIP EAFRGVHRYL SNAYAREEFA STCPDDEEIE LAYEQVAKAL KDegré de pureté :Min. 95%BNIP1 antibody
BNIP1 antibody was raised in rabbit using the C terminal of BNIP1 as the immunogen
Degré de pureté :Min. 95%XRCC5 antibody
The XRCC5 antibody is a cytotoxic monoclonal antibody that specifically targets XRCC5, a protein involved in DNA repair. This antibody has been shown to have high specificity and affinity for XRCC5, making it an effective tool for studying the function of this protein in various biological processes. The XRCC5 antibody can be used in applications such as immunohistochemistry, western blotting, and flow cytometry to detect and quantify XRCC5 levels in different cell types and tissues. Additionally, this antibody has potential therapeutic applications, as it can induce cell death in cancer cells that overexpress XRCC5. Overall, the XRCC5 antibody is a valuable research tool for scientists studying DNA repair mechanisms and developing targeted therapies for cancer treatment.SKP2 antibody
The SKP2 antibody is a highly activated and colloidal growth factor that belongs to the class of antibodies. It is a monoclonal antibody that has neutralizing properties and can effectively target autoantibodies. This antibody undergoes acid modifications, such as glycosylation, which enhance its stability and efficacy. The SKP2 antibody specifically targets the protein kinase SKP2, which plays a crucial role in cell cycle regulation and tumor development. In Life Sciences research, this monoclonal antibody is widely used for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Its high specificity and affinity make it an ideal test compound for studying the functions of SKP2 in cellular processes.Goat anti Human IgG (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain).Degré de pureté :Min. 95%SLC9A8 antibody
SLC9A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL
Degré de pureté :Min. 95%Alpha synuclein antibody
The Alpha synuclein antibody is a cytotoxic antibody used in Life Sciences. It is available in both polyclonal and monoclonal forms. This antibody specifically targets alpha synuclein, a protein that is associated with neurodegenerative diseases such as Parkinson's disease. The alpha synuclein antibody can be used for research purposes to study the role of this protein in various cellular processes.PYHIN1 antibody
PYHIN1 antibody was raised in rabbit using the N terminal of PYHIN1 as the immunogenDegré de pureté :Min. 95%TRIM49 antibody
TRIM49 antibody was raised using the N terminal of TRIM49 corresponding to a region with amino acids RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFDBH antibody
DBH antibody was raised in rabbit using an 18 amino acid peptide of human DBH as the immunogen.Degré de pureté :Min. 95%Annexin A2 antibody
Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDDPerforin antibody
Perforin antibody was raised in rabbit using E. coli-expressed rat perforin as the immunogen.Degré de pureté :Min. 95%SIGLEC6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6067Degré de pureté :Min. 95%TGFBR2 antibody
The TGFBR2 antibody is a polyclonal antibody that specifically targets the transforming growth factor beta receptor 2 (TGFBR2). It is commonly used in research and diagnostic applications to detect and quantify the expression of TGFBR2. This antibody binds to the activated form of TGFBR2, inhibiting its interaction with other proteins involved in signal transduction pathways. Additionally, it has been shown to block the binding of interferon-gamma (IFN-gamma) to TGFBR2, suggesting a potential role in modulating immune responses. The TGFBR2 antibody is available as both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it a valuable tool for studying the function and regulation of TGFBR2 in various biological systems.
NRG4 antibody
The NRG4 antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of nuclear retinoid receptors. It has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. The NRG4 antibody works by blocking the acetylation process that is crucial for the activation of retinoid receptors, thereby preventing their interaction with DNA and subsequent gene expression. This inhibition has been shown to have significant effects on various cellular processes, including collagen production, which makes it a valuable tool for studying and understanding the role of retinoids in cell biology. Additionally, the NRG4 antibody can be used in the development of novel medicines and vaccines targeting retinoid-related diseases and disorders. Its specificity and efficacy make it an essential component in research and diagnostic applications requiring reliable and accurate detection of retinoid receptors.RORA antibody
The RORA antibody is a highly specialized antibody that targets the retinoid-related orphan receptor alpha (RORA). This receptor plays a crucial role in regulating gene expression and is involved in various biological processes, including immune response, metabolism, and circadian rhythm. The RORA antibody can be used for research purposes in the field of life sciences to study the function and activity of this important receptor.CYTB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYTB antibody, catalog no. 70R-7028Degré de pureté :Min. 95%FOXN1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection and contains active compounds known for their bactericidal activity. Through its unique mechanism, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has been conducted using the patch-clamp technique on human erythrocytes, demonstrating its high efficacy in human subjects.GSTK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GSTK1 antibody, catalog no. 70R-2610
Degré de pureté :Min. 95%CLEC4M Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLEC4M antibody, catalog no. 70R-8545Degré de pureté :Min. 95%TIMELESS antibody
TIMELESS antibody was raised in rabbit using the N terminal of TIMELESS as the immunogenDegré de pureté :Min. 95%TMEM93 antibody
TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
Degré de pureté :Min. 95%ZNF596 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF799 antibody, catalog no. 70R-8173Degré de pureté :Min. 95%TMEM187 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM187 antibody, catalog no. 70R-7383Degré de pureté :Min. 95%HDAC10 antibody
The HDAC10 antibody is a highly specific monoclonal antibody that targets the histone deacetylase 10 (HDAC10) protein. HDAC10 is a member of the histone deacetylase family that plays a crucial role in gene expression regulation. This antibody is widely used in Life Sciences research to study the function and activity of HDAC10.
SCAMP3 antibody
SCAMP3 antibody was raised in rabbit using the N terminal of SCAMP3 as the immunogenDegré de pureté :Min. 95%SLCO6A1 antibody
SLCO6A1 antibody was raised using the C terminal of SLCO6A1 corresponding to a region with amino acids LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNKMatrin 3 antibody
Matrin 3 antibody was raised using the N terminal of MATR3 corresponding to a region with amino acids MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTAC1QTNF4 antibody
C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids RRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELDegré de pureté :Min. 95%HDAC10 antibody
The HDAC10 antibody is a growth factor that belongs to the class of Monoclonal Antibodies. It acts as a protein kinase inhibitor and exhibits antiangiogenic properties. This antibody specifically targets epidermal growth factor (EGF) and inhibits its activity. It has been shown to block the activation of the EGF receptor, preventing downstream signaling pathways involved in cell proliferation and survival. The HDAC10 antibody can also bind to erythropoietin (EPO) and inhibit its cytotoxic effects. This monoclonal antibody is widely used in Life Sciences research for studying the role of EGF and EPO in various cellular processes. Its specificity and high affinity make it an excellent tool for investigating the mechanisms of action of growth factors and their receptors.CD4 antibody (Spectral Red)
CD4 antibody (Spectral Red) was raised in rat using cloned murine CTL line V4 as the immunogen.
PRAC antibody
PRAC antibody was raised in rabbit using human PRAC protein as the immunogen.Degré de pureté :Min. 95%CIDE3 antibody
CIDE3 antibody was raised in rabbit using residues 10-25 [LLYPKSLSRHVSVRTS] of the 27 kDa human CIDE-3 protein as the immunogen.Degré de pureté :Min. 95%PIP5KL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PIP5KL1 antibody, catalog no. 70R-2043Degré de pureté :Min. 95%MTH1 antibody
The MTH1 antibody is a growth factor that plays a crucial role in various biological processes. It acts as a neutralizing agent against chemokines, helicobacter proteins, and TGF-beta. This monoclonal antibody is widely used in the field of Life Sciences for its ability to target specific molecules and inhibit their activity. Additionally, the MTH1 antibody has been shown to have therapeutic potential when combined with other drugs such as olaparib. It can also be used as a research tool for studying phosphatase activity, ferritin levels, interleukin-6 signaling, collagen synthesis, and immobilization processes. With its versatility and specificity, the MTH1 antibody is an essential tool for researchers in various fields.NANP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NANP antibody, catalog no. 70R-4175Degré de pureté :Min. 95%BASP1 antibody
BASP1 antibody was raised in rabbit using the N terminal of BASP1 as the immunogen
Degré de pureté :Min. 95%HIV1 gp120 antibody (biotin)
HIV1 gp120 antibody (biotin) was raised in goat using purified native gp120 from strain IIIB as the immunogen.ADSSL1 antibody
ADSSL1 antibody was raised using the middle region of ADSSL1 corresponding to a region with amino acids VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS
SLC25A16 antibody
SLC25A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRDegré de pureté :Min. 95%ATG4D Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATG4D antibody, catalog no. 70R-9614Degré de pureté :Min. 95%CD71 antibody
The CD71 antibody is a polyclonal antibody that is widely used in Life Sciences research. It is commonly used in studies involving neuroprotection, as well as the detection and quantification of active agents. The CD71 antibody has been shown to have a high affinity for methyl methanesulfonate (MMS), a genotoxic agent often used in genotoxicity assays. Additionally, this antibody can be conjugated with fluorescent calcium indicators to study intracellular calcium dynamics. It is also commonly used in the detection of autoantibodies and growth factors. The CD71 antibody has been validated in various assays, including the micronucleus test, and has shown excellent performance and specificity. Its use can provide valuable insights into cellular processes and signaling pathways.Fibrillarin antibody
Fibrillarin antibody was raised using the N terminal of FBL corresponding to a region with amino acids GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNGlicentin/Glucagon antibody
Glicentin/Glucagon antibody was raised in rabbit using Porcine pancreatic glucagon conjugated to BSA as the immunogen.Degré de pureté :Min. 95%MGC70863 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MGC70863 antibody, catalog no. 70R-4813Degré de pureté :Min. 95%CHN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHN1 antibody, catalog no. 70R-5735Degré de pureté :Min. 95%PARD3 antibody
PARD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNRDegré de pureté :Min. 95%Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 86-90 of cTnI as the immunogen.Rsk1 antibody
Rsk1 antibody was raised in Mouse using a purified recombinant fragment of human Rsk1 expressed in E. coli as the immunogen.Myeloperoxidase protein
Myeloperoxidase protein is a hormone and globulin that plays a crucial role in endothelial growth and binding proteins. It acts as a growth factor, promoting the development and maintenance of blood vessels. The protein also has phosphatase activity, which regulates various signaling pathways involved in cell growth and differentiation.Degré de pureté :Min. 95%CDC37 antibody
The CDC37 antibody is a growth factor that plays a crucial role in various biological processes. It is a colloidal fatty acid that regulates thrombocytopenia, chemokine production, and interleukin-6 signaling. The CDC37 antibody is a monoclonal antibody that specifically targets the family kinase inhibitor, collagen, and other growth factors. It can be used in research and diagnostic applications to study the effects of these proteins on cell signaling pathways. Additionally, polyclonal antibodies against CDC37 are available for use in various immunoassays. With its high viscosity and potent inhibitory properties, the CDC37 antibody is an essential tool for scientists studying growth factor-related processes.ACOT2 antibody
ACOT2 antibody was raised using the middle region of ACOT2 corresponding to a region with amino acids SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRMPP5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MPP5 antibody, catalog no. 70R-3081Degré de pureté :Min. 95%IL4 protein (His tag)
25-153 amino acids: MGSSHHHHHH SSGLVPRGSH MHKCDITLQE IIKTLNSLTE QKTLCTELTV TDIFAASKNT TEKETFCRAA TVLRQFYSHH EKDTRCLGAT AQQFHRHKQL IRFLKRLDRN LWGLAGLNSC PVKEANQSTL ENFLERLKTI MREKYSKCSSDegré de pureté :Min. 95%MARCKS antibody
The MARCKS antibody is a highly specialized protein kinase that plays a crucial role in various cellular processes. It is activated by β-catenin and has been shown to have anti-glial fibrillary acidic properties. This antibody can be used for research purposes, as it can specifically bind to the target protein and inhibit its activity. The MARCKS antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the option that best suits their needs. Additionally, this antibody has been tested on liver microsomes and has shown promising results. With its high specificity and reactivity, the MARCKS antibody is a valuable tool for studying cellular pathways and developing targeted therapies.Degré de pureté :Min. 95%Tmem184b antibody
Tmem184b antibody was raised in rabbit using the middle region of Tmem184b as the immunogenDegré de pureté :Min. 95%JAK1 antibody
The JAK1 antibody is a highly specialized growth factor that binds to specific receptors in the body. It belongs to the class of antibodies known as colloidal antibodies, which have unique properties that enhance their efficacy. With its high viscosity and acetyltransferase activity, the JAK1 antibody is widely used in Life Sciences research for its cytotoxic effects on target cells.Degré de pureté :Min. 95%CCR7 antibody
The CCR7 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to the activated form of CCR7, a chemokine receptor involved in immune cell migration. This antibody is derived from human serum and is widely used for research purposes.Degré de pureté :Min. 95%KLH antibody
The KLH antibody is a highly specialized protein that plays a crucial role in various biological processes. It is an essential component of the transferrin and DNA aptamer systems, which are responsible for transporting molecules and regulating gene expression, respectively. Additionally, the KLH antibody has been shown to interact with TGF-β1, a key signaling molecule involved in cell growth and differentiation.HIV1 p24 antibody
HIV1 p24 antibody was raised in goat using purified native p24 from strain IIIB as the immunogen.
Degré de pureté :Min. 95%Mouse Brain antibody
Mouse brain antibody was raised in rabbit using brain tissue from BALB/c mice as the immunogen.Degré de pureté :Min. 95%
