Produits biochimiques et réactifs

Tebuquine is a potent and selective blocker of voltage-gated ion channels, which are proteins that control the passage of ions across cell membranes. Tebuquine is a useful research tool for studying protein interactions and determining the effects of drugs on ion channels. It can be used to block potassium channels, which regulate the amount of potassium ions in cells. It has been shown to inhibit the activity of receptor-activated ion channels and to activate ligand-gated ion channels. Tebuquine has been shown to bind to calcium-activated potassium channels with high affinity, but does not bind to calcium-activated chloride or sodium channels. This drug also blocks voltage-gated calcium (Ca) channels in cultured rat neurons with an IC50 value of approximately 0.1 µM.

GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV

2-((5-Chloropyridin-2-yl)amino)-N-(3,5-difluorophenethyl)acetamide is a small molecule that inhibits the ion channels TRPM8 and TRPA1. It is an inhibitor of TRPM8 and has been shown to inhibit the activity of TRPA1 in vitro. It may be used as a research tool for studying protein interactions, receptor pharmacology, peptides, activator ligands, ion channels and ligand binding.

Amino acids 13-34 of the Parathyroid Hormone (PTH) which is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 0.5mg vial.

Please enquire for more information about Spiro almotriptan including the price, delivery time and more detailed product information at the technical inquiry form on this page

Heptamethine cyanine dye-1 is a fluorescent dye that binds to ion channels and can be used as a research tool to study the interactions between ion channels, ligands, and receptors. Heptamethine cyanine dye-1 can also be used to determine the function of ion channels in cells by using fluorescence microscopy. It has been shown to activate or inhibit ion channels depending on its environment and can be used as a high purity reagent in research.
Heptamethine cyanine dye-1 is a synthetic fluorescent probe for studying protein interactions with peptides or antibodies. This probe has been shown to bind specifically to certain proteins or peptides, making it useful for determining antibody specificity. Heptamethine cyanine dye-1 has also been shown to bind to specific cell membranes, which makes it an ideal tool for investigating protein localization at the cellular level.

(R)-5-Fluoro-N-(4-fluoro-3-(3-imino-2,5-dimethyl-1,1-dioxido-1,2,4-thiadiazinan-5-yl)phenyl)picolinamide 2,2,2-trifluoroacetate is a sophisticated chemical compound, primarily utilized in the field of pharmaceutical research. Derived from synthetic organic chemical processes, this compound represents a class of advanced heteroaryl amides with potential bioactive properties. Its unique mode of action is centered on its ability to engage in binding interactions, presumably with specific protein targets or enzymes, influencing molecular pathways related to disease states.

Furobufen is a potent inhibitor of the enzyme c-Jun N-terminal kinase. It blocks the activity of this enzyme, which is involved in the regulation of cell proliferation, differentiation and apoptosis. Furobufen is therefore used as a research tool to study the role of c-Jun N-terminal kinase in these processes. Furobufen also binds to and inhibits protein interactions such as receptor and ligand interactions, and ion channel activity. Furobufen has been shown to act as an antagonist of potassium channels, which are important for regulating membrane potentials and cellular excitability.

Purified recombinant ARC protein (His tag)

Rabbit polyclonal TACC1 antibody

DBCO-dPEG®12-Carboxyfluorescein is a PEG compound containing a fluorescein dye used for tagging biomolecules, and serving as fluorescent probe for bioimaging applications.

3'-Hydroxyechinenone is an analog of a natural compound found in Chinese medicinal herbs. It is a potent inhibitor of protein kinases, which are enzymes that play a crucial role in cancer cell growth and survival. 3'-Hydroxyechinenone has been shown to induce apoptosis, or programmed cell death, in tumor cells by blocking the activity of specific kinases. This compound has also demonstrated anticancer activity in human cancer cell lines and has potential as a therapeutic agent for the treatment of various types of cancer. Additionally, 3'-Hydroxyechinenone can be detected in urine samples and may serve as a biomarker for cancer diagnosis and monitoring. Overall, this inhibitor shows great promise as a novel approach to treating cancer.

3,5-Difluoro-L-tyrosine is a fluorinated amino acid, which is synthesized through chemical modification of L-tyrosine. This compound is a product of organic synthesis processes, typically starting with L-tyrosine, a naturally occurring amino acid, and introducing fluorine atoms at specific positions on the phenyl ring. The introduction of fluorine atoms significantly alters the chemical properties of the tyrosine moiety, allowing it to function as a probe or substitute in various biochemical applications.

DS21360717 is a synthetic compound, classified as a small-molecule inhibitor, which originates from advanced chemical synthesis techniques within pharmaceutical research. Its mode of action involves targeting and modulating specific cellular pathways, often through inhibiting key enzymes or receptors involved in disease processes. This targeted interaction allows for precise modulation of biological reactions, making it a valuable tool in both research and therapeutic settings.

Verdalia A is an anticancer compound that acts as a kinase inhibitor by binding to cyclin-dependent kinases and preventing the phosphorylation of target proteins. This inhibition leads to apoptosis, or programmed cell death, in human cancer cells. Verdalia A has been shown to be effective against a variety of cancers, including Chinese hamster ovary (CHO) cells and human tumor cell lines. It also has glutathione analog activity, which may contribute to its anticancer properties. As a promising new class of kinase inhibitors, Verdalia A holds great potential for the development of novel cancer therapies.

PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT

Rabbit polyclonal XDH antibody

Portion of EBV EBNA3A

EMD386088 is a selective phosphoinositide 3-kinase (PI3K) inhibitor, which is a compound of synthetic origin designed to target specific kinases involved in cell signaling pathways. It functions by selectively inhibiting the activity of PI3K enzymes, which play a critical role in multiple cellular processes, including cell growth, proliferation, and survival. Through its mode of action, EMD386088 disrupts the PI3K/AKT/mTOR signaling pathway, a pivotal regulatory axis often implicated in various malignancies.