Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(100.866 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.368 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
cRAF antibody
The cRAF antibody is a fatty acid-based medicament that is widely used in the Life Sciences field. It belongs to the category of antibodies, specifically Polyclonal Antibodies. This antibody is highly effective against activated cRAF, which is a key enzyme involved in various cellular processes. The cRAF antibody has been shown to neutralize the activity of cRAF by binding to its active site and preventing its interaction with downstream signaling molecules. Additionally, this antibody has demonstrated excellent specificity, as it does not cross-react with other proteins such as glial fibrillary acidic protein or EGF-like glycoprotein. Its neutralizing properties make it an ideal tool for studying the role of cRAF in different cell types and physiological conditions.ACY1 antibody
The ACY1 antibody is a potent colony-stimulating factor that is derived from pluripotent stem cells. It is widely used in the field of Life Sciences for various applications. The ACY1 antibody has been shown to have a high affinity for collagen and can be used in antigen-antibody reactions. It is commonly used in research studies to detect the presence of specific proteins or molecules in samples. The ACY1 antibody is produced using a monoclonal antibody technique, ensuring high specificity and consistency. This mouse monoclonal antibody has shown neutralizing properties against parathyroid hormone-related peptide and can effectively inhibit its activity. Additionally, the ACY1 antibody can bind to membrane collagen and cell antibodies, making it a valuable tool for studying cellular processes and interactions.GRAP antibody
GRAP antibody was raised using the middle region of GRAP corresponding to a region with amino acids KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDS100B protein
S100B protein is a Recombinant Protein & Antigen that plays a crucial role in various biological processes. It has been found to interact with antiphospholipid antibodies, interferon, β-catenin, epidermal growth factor, and anti-her2 antibody. This protein is involved in the regulation of cellular processes such as cell proliferation, differentiation, and apoptosis.Degré de pureté :Min. 95%AhR antibody
The AhR antibody is a monoclonal antibody that specifically targets and neutralizes the aryl hydrocarbon receptor (AhR). This protein complex plays a crucial role in various biological processes, including cell growth and differentiation. By inhibiting the activation of AhR, this antibody prevents the downstream signaling events that are triggered by its activation.ABCA12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ABCA12 antibody, catalog no. 70R-7156Degré de pureté :Min. 95%KCNA3 antibody
The KCNA3 antibody is a specific antibody that targets the KCNA3 protein. This protein plays a crucial role in various cellular processes, including cell signaling and ion channel regulation. The KCNA3 antibody is widely used in life sciences research to study the function of this protein and its involvement in different diseases.SKP2 antibody
The SKP2 antibody is a monoclonal antibody that specifically targets and inhibits the activity of SKP2 (S-phase kinase-associated protein 2). SKP2 is a nuclear protein that plays a crucial role in regulating cell cycle progression by promoting the degradation of key cell cycle inhibitors. By blocking the function of SKP2, this antibody helps to prevent uncontrolled cell growth and proliferation.PCDHGC4 antibody
PCDHGC4 antibody was raised using the N terminal of PCDHGC4 corresponding to a region with amino acids VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVSDegré de pureté :Min. 95%SERPINI2 antibody
SERPINI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFDegré de pureté :Min. 95%Streptococcus Group A antibody (HRP)
Streptococcus group A antibody (HRP) was raised in goat using group A streptococci as the immunogen.Degré de pureté :Min. 95%SMANT hydrochloride
CAS :SMANT hydrochloride is a peptide that is used in research as a tool for investigating protein interactions and the effects of ligands on receptors. SMANT hydrochloride binds to ion channels and receptor proteins, which modulates their activity. The SMANT hydrochloride molecule has an inhibitor effect on certain enzymes such as ATPases and transporters. It also inhibits the production of reactive oxygen species by activating the Nrf2 transcription factor, which regulates antioxidant genes.Formule :C16H23BrN2O·HClDegré de pureté :Min. 95%Masse moléculaire :375.73 g/molCOX4I1 antibody
COX4I1 antibody was raised in Mouse using a purified recombinant fragment of human COX4I1 expressed in E. coli as the immunogen.KIF5B antibody
KIF5B antibody was raised using the N terminal of KIF5B corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTDegré de pureté :Min. 95%ZNF582 antibody
ZNF582 antibody was raised in rabbit using the N terminal of ZNF582 as the immunogenDegré de pureté :Min. 95%PROTAC ERRα Degrader-2
CAS :PROTAC ERRα Degrader-2 is an antibody that binds to the alpha subunit of the estrogen receptor, a nuclear transcription factor. It is a research tool for studying the molecular mechanisms of estrogen regulation in cells and for identifying potential therapeutic targets. The antibody has been shown to inhibit protein interactions with estrogen receptor alpha and to activate ligand-dependent signaling pathways. PROTAC ERRα Degrader-2 also has high purity, as it is made of pure recombinant proteins. This antibody can be used as a diagnostic tool for biomarker discovery in cancer and other diseases.Formule :C57H55Cl2F6N7O8Degré de pureté :Min. 95%Masse moléculaire :1,151 g/molHAO2 antibody
HAO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVWAURKA antibody
The AURKA antibody is a highly effective neutralizing agent used in Life Sciences research. It belongs to a class of inhibitors that target specific proteins involved in cellular processes. This monoclonal antibody has been extensively tested and proven to be highly cytotoxic against various cancer cell lines. In addition, it has shown promising results in inhibiting the growth factor signaling pathway and blocking the activity of leukemia inhibitory factor. The AURKA antibody is derived from human serum and exhibits excellent specificity and affinity for its target protein. Its colloidal nature allows for easy handling and application in various experimental setups. Researchers can rely on this monoclonal antibody to accurately detect and quantify the presence of hormone peptides, autoantibodies, and other biomolecules of interest.
B3GALTL antibody
B3GALTL antibody was raised using the middle region of B3GALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREEDegré de pureté :Min. 95%Goat anti Rabbit IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Degré de pureté :Min. 95%AR antibody
The AR antibody is a monoclonal antibody that specifically targets the androgen receptor (AR). It has been extensively studied and proven to be highly effective in various research applications within the Life Sciences field. The AR antibody can be used for experiments involving alpha-fetoprotein, endogenous hematopoietic cells, epidermal growth factor signaling, actin filaments, growth factors, fibronectin, chemokines, antibodies, interferon-gamma (IFN-gamma), human folate metabolism, and many other areas of study.4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine
CAS :4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine, also known as BromoBZAT, is a peptide that can be used as a research tool and an activator. It has been shown to activate the ion channels in cells and inhibit protein interactions. This product is highly pure and is sold for research purposes only.Formule :C14H11BrN2SDegré de pureté :Min. 95%Masse moléculaire :319.22 g/molMC4R antibody
MC4R antibody is a polyclonal antibody that specifically targets the melanocortin 4 receptor (MC4R). It is widely used in life sciences research to study adipose tissue and its related functions. This antibody has been shown to have neutralizing properties against angptl3, a protein involved in lipid metabolism. The MC4R antibody can be used in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA). It is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their experiments. With its high specificity and sensitivity, the MC4R antibody is an essential tool for studying the role of MC4R in various physiological processes and developing potential therapeutic interventions.CD28 antibody (biotin)
CD28 antibody (biotin) was raised in hamster using CD28 costimulatory receptor as the immunogen.Degré de pureté :Min. 95%LAMP2 antibody
LAMP2 antibody was raised in Rabbit using Human LAMP2 as the immunogen. Functions by binding target proteins, such as GAPDH and MLLT11, and targeting them for lysosomal degradation. Plays a role in lysosomal protein degradation in response to starvation.OICR-0547
CAS :OICR-0547 is a small molecule that was identified by the OICR consortium as a potential antibiotic. It has been shown to have broad-spectrum activity against Gram-positive and Gram-negative bacteria, including drug-resistant strains. OICR-0547 binds to the bacterial ribosome and inhibits protein synthesis, which leads to cell death. The compound also has an inhibitory effect on the growth of several yeast species and mammalian cells. The binding of OICR-0547 to the ribosome induces a change in conformation that prevents peptidyl transferase from synthesizing proteins. This inhibition of translation leads to cell death because it prevents production of proteins vital for cell division. In addition, OICR-0547 inhibits the growth of methicillin resistant Staphylococcus aureus (MRSA), Enterococcus faecalis, Enterobacter cloacae, Pseudomonas aeruginosa, BurkholderiaFormule :C28H29F3N4O4Degré de pureté :Min. 95%Masse moléculaire :542.55 g/molAFP 464
CAS :AFP 464 is an activating agent that binds to the molecular target, which is thought to be growth rate. AFP 464 has been shown to increase the activation of cancer cells and cause a change in their phenotype. It also has anti-tumor effects on kidney cancer cells and other carcinoma cells. AFP 464 is potently activated by spontaneous sequestration or postulated mechanisms. Treatment with AFP 464 has been shown to produce a decrease in tumor size and weight as well as an increase in life span for mice with kidney cancer.
Formule :C22H23F3N4O3Degré de pureté :Min. 95%Masse moléculaire :448.4 g/molPolystyrene M NH2 (5 µm)
Polystyrene is a thermoplastic polymer that is used in the production of polystyrene resins, which are used as building blocks for peptide synthesis. New England Peptide offers a variety of polystyrene resin products including particle resins and Rapp Polymere resins. The particle size of the resin ranges from 5-100 µm. Polymers can be synthesized using various methods including solid-phase synthesis and solution phase synthesis, which both require polystyrene resins. This product is available with a variety of functionalities, such as amine, hydroxyl and carboxyl groups.
Degré de pureté :Min. 95%PF 05089771
CAS :PF 05089771 is a ligand that has been shown to activate the G-protein coupled receptor, GPRC6A. It has also been shown to inhibit the activity of protein kinase A and protein phosphatase 1D. PF 05089771 is a research tool for studying the ion channels and peptides that are involved in cell biology and cell signaling. This compound is an antibody inhibitor and can be used as a research tool for studying protein interactions.Formule :C25H20Cl2FN5O6S3Degré de pureté :Min. 95%Masse moléculaire :672.56 g/mol17:0 PE
CAS :Palmitoleic acid (17:0) is a fatty acid that plays an important role in regulating the function of mitochondria. It has been shown to be reactive and may play a role in the development of cancer, but it also has antioxidant properties. Palmitoleic acid (17:0) is synthesized from acetyl-CoA, which is derived from malonyl-CoA and acetyl-CoA. The enzyme carnitine palmitoyltransferase catalyzes this reaction, converting malonyl-CoA to malonyl-acylcarnitine, which then undergoes β oxidation to form acetyl-CoA and palmitoleic acid (17:0). In addition to its regulatory effects, palmitoleic acid (17:0) also acts as a photosynthetic pigment that absorbs light energy for photosynthesis. The measurement of 17:0 PE concentrations can be used as an indicator of photosynthetic activity in
Formule :C39H78NO8PDegré de pureté :Min. 95%Masse moléculaire :720.01 g/mol(±)-Clopidogrel-(phenyl-13C6)
CAS :(±)-Clopidogrel-(phenyl-13C6) is a potent, selective and competitive antagonist of the thromboxane A2 receptor. It is a pharmacological tool for studying protein interactions with the thromboxane A2 receptor. (±)-Clopidogrel-(phenyl-13C6) has been shown to inhibit ion channels and ligand-gated ion channels, as well as to block certain voltage-activated calcium channels. This agent also binds to antibodies that are specific for the thromboxane A2 receptor, making it useful in cell biology and antibody studies. (±)-Clopidogrel-(phenyl-13C6) is an inhibitor of platelet aggregation, which may be due to its ability to bind with high affinity to the peptide sequence Glu-Leu-Arg on the platelet surface.Formule :C6C10H16ClNO2SDegré de pureté :Min. 95%Masse moléculaire :327.78 g/molSynuClean D
CAS :Inhibits aggregation of α-synuclein by binding to the inner cavity of α-synuclein fibrils. α-synuclein is a major component of amyloid deposition in dopaminergic neurons of Parkinson’s patients. SynuCleanD has therapeutic potential in Parkinson’s disease as it can prevent the degeneration of dopaminergic neurons.Formule :C13H5F3N4O5Degré de pureté :Min. 95%Masse moléculaire :354.2 g/molBecampanel
CAS :Becampanel is a linker drug that binds to the adenosine A1 receptor and blocks nerve transmission. It is used to treat chronic pain, postoperative pain, and neuropathic pain. Becampanel has been shown to be effective in reducing diabetic neuropathy and Alzheimer's disease. This drug has been shown to have a synergistic effect when combined with cholinesterase inhibitors, which are drugs that inhibit the breakdown of acetylcholine by cholinesterases. The combination of becampanel with an acetylcholine esterase inhibitor produces a significant reduction in the symptoms of chronic pain.Formule :C10H11N4O7PDegré de pureté :Min. 95%Masse moléculaire :330.19 g/molMAP2 antibody
MAP2 antibody was raised in rabbit using residues 2-15 [ADERKDEGKAPHWT] of the 72 kDa and 280 kDa forms of the human MAP2 as the immunogen.Degré de pureté :Min. 95%AK1 antibody
The AK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect collagen, making it an essential tool for studying collagen-related processes. This antibody is commonly used in immunoassays and other experimental techniques to detect the presence of collagen in various samples.Luminespib
CAS :Inhibitor of heat shock protein Hsp90Formule :C26H31N3O5Degré de pureté :Min. 95%Masse moléculaire :465.54 g/molHGS antibody
HGS antibody is a polyclonal antibody that specifically targets endosomes. This antibody is used in various applications, including immunological research and therapeutic purposes. It has been shown to have an inhibiting effect on the antigen-presenting function of endosomes, making it a valuable tool for studying immunomodulation. Additionally, HGS antibody has demonstrated antinociceptive properties, suggesting its potential use in pain management. With its wide range of applications and proven effectiveness, HGS antibody is a crucial component in the field of Life Sciences.1-Deoxyfructosyl-Gly
CAS :1-Deoxyfructosyl-Gly is a multifunctional inhibitor that has been shown to inhibit the activity of protein interactions, activator, ligand, and receptor. It is a research tool used to investigate the role of ion channels in cell biology. The antibody has high purity and is suitable for use in life science research.
Formule :C8H15NO7Degré de pureté :Min. 95%Masse moléculaire :237.21 g/molSch412348
CAS :Sch 412348 is a potent and selective inhibitor of the human protein kinase C (PKC) δ isozyme. Sch 412348 inhibits PKCδ by binding to the ATP binding site, thus blocking the enzyme's activity. Sch 412348 is a peptide that can be used as a research tool in cell biology, pharmacology, and other life sciences. It can also be used as an antibody or as a ligand for receptor studies.Formule :C22H21F2N9ODegré de pureté :Min. 95%Masse moléculaire :465.5 g/molBCAP31 antibody
BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Degré de pureté :Min. 95%α 2 Macroglobulin protein
Alpha 2 Macroglobulin protein is a versatile molecule that plays a crucial role in various biological processes. In the field of Life Sciences, it is widely recognized for its ability to neutralize proteases, thereby protecting tissues from degradation. Additionally, alpha 2 Macroglobulin protein has been found to be involved in adipose tissue function and regulation.Degré de pureté :>95% By Sds-PageDiltiazem-d3 hydrochloride
CAS :Diltiazem-d3 is a high purity, water soluble form of diltiazem. Diltiazem-d3 is an inhibitor of phosphodiesterase (PDE) and an activator of potassium channels. It has been used in research as a tool to study the interaction between PDEs and potassium channels.Formule :C22H27ClN2O4SDegré de pureté :Min. 95%Masse moléculaire :454 g/molCCPG1 antibody
CCPG1 antibody was raised using the middle region of CCPG1 corresponding to a region with amino acids TNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKEDegré de pureté :Min. 95%GATA4 antibody
The GATA4 antibody is a highly reactive antibody used in Life Sciences research. It is specifically designed to target and bind to the GATA4 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying GATA4 levels in liver microsomes.APLNR antibody
APLNR antibody was raised in rabbit using the N terminal of APLNR as the immunogenDegré de pureté :Min. 95%BMP 7 Human
BMP 7 is a cytokine that belongs to the transforming growth factor beta (TGF-β) superfamily. It is produced by many cell types, including E. coli, in response to TGF-β and IL-1. BMP 7 has been shown to be involved in the regulation of cell proliferation and differentiation. BMP 7 has also been shown to be a potent inducer of cytokines such as IL-8, IL-6, IL-1β, and TNF-α from human mononuclear cells.Degré de pureté :Min. 95%(D-Ser4,D-Ser(tBu)6,Azagly10)-LHRH
CAS :Please enquire for more information about (D-Ser4,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C59H84N18O14Degré de pureté :Min. 95%Masse moléculaire :1,269.41 g/molCD3e antibody (biotin)
CD3e antibody (biotin) was raised in mouse using porcine CD3e as the immunogen.Degré de pureté :Min. 95%KX2-391 dihydrochloride
CAS :KX2-391 is a peptide inhibitor of the protein tyrosine phosphatases PTP1B and SHP-2. KX2-391 binds to the active site of PTP1B, which is located in the cytoplasm. This binding blocks the dephosphorylation of various substrates including phosphotyrosine residues on proteins such as insulin receptor substrate 1 (IRS-1), thereby preventing signaling pathways that are mediated by tyrosine kinase activity. KX2-391 also inhibits SHP-2, a protein tyrosine phosphatase that regulates cellular proliferation and differentiation. KX2-391 has been shown to activate protein kinase C (PKC) and cAMP response element binding protein (CREB). KX2-391 can be used as a research tool for studying PKC and CREB activation, or as an antibody for immunohistochemistry studies.Formule :C20H20N4O·HClDegré de pureté :Min. 95%Masse moléculaire :368.86 g/mol2,4-Diisopropyl-5-methylphenol
CAS :2,4-Diisopropyl-5-methylphenol is an antipyrine derivative. It is used as a topical antineoplastic drug in the treatment of women with capitata and conformation abnormalities. 2,4-Diisopropyl-5-methylphenol has also been used to treat infantile phaeohyphomycosis caused by Capitata flecainide. The serum level of 2,4-diisopropyl-5-methylphenol is increased during long term administration due to its accumulation in tissues. This accumulation results in neutropenia and other side effects such as nausea and vomiting.
Formule :C13H20ODegré de pureté :Min. 95%Masse moléculaire :192.3 g/molMethyl 5-fluoro-2-(2-(1-methyl-1H-1,2,4-triazol-5-yl)acetyl)-3-nitrobenzoate
CAS :Methyl 5-fluoro-2-(2-(1-methyl-1H-1,2,4-triazol-5-yl)acetyl)-3-nitrobenzoate is a synthetic organic compound, which is derived from aromatic benzoate structures enhanced with fluorine, nitro, and triazole moieties. The source of this compound lies in advanced synthetic chemistry techniques, involving multiple steps that introduce these functional groups to a benzoate core, thereby enhancing its physicochemical properties.Formule :C13H11FN4O5Degré de pureté :Min. 95%Masse moléculaire :322.25 g/molDonkey anti Rat IgG (H + L) (rhodamine)
Donkey anti-rat IgG (H + L) (rhodamine) was raised in donkey using Rat IgG (H&L) as the immunogen.
Degré de pureté :Min. 95%GPR56 antibody
GPR56 antibody was raised using the N terminal of GPR56 corresponding to a region with amino acids MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNDegré de pureté :Min. 95%RELM alpha antibody
RELM alpha antibody was raised in rabbit using residues 31-44 of the mouse RELMalpha protein as the immunogen.Degré de pureté :Min. 95%TAK 901
CAS :Inhibitor of Aurora B kinaseFormule :C28H32N4O3SDegré de pureté :Min. 95%Masse moléculaire :504.64 g/mol19 Nortestosterone-HRP
19-Nortestosterone 17 Conjugate for use in immunoassaysDegré de pureté :Min. 95%CCR5 antibody
CCR5 antibody is a type of inhibitor that targets the chemokine receptor CCR5. It has been shown to neutralize the activity of CCR5 and inhibit its interaction with human serum and actin filaments. This antibody is commonly used in Life Sciences research to study the role of CCR5 in various cellular processes. Additionally, it has been found to have potential therapeutic applications in autoimmune diseases and cancer treatment. The CCR5 antibody can also be used in conjunction with other antibodies or drugs, such as taxol, to enhance their effectiveness. Its ability to modulate interferon gamma (IFN-gamma) signaling and growth factor pathways makes it a valuable tool for studying immune responses and cell growth regulation.Degré de pureté :Min. 95%CDC42 antibody
The CDC42 antibody is a highly effective medicament that targets cell cytotoxicity and growth factor signaling pathways. It specifically binds to phosphorylcholine, a key component in the activation of CDC42, a small GTPase protein involved in various cellular processes. This monoclonal antibody has been extensively studied in Life Sciences and has shown promising results in inhibiting the carcinogenic properties of activated CDC42.TRKB antibody
The TRKB antibody is a glycopeptide that belongs to the class of polyclonal antibodies. It specifically targets the TRKB receptor, which plays a crucial role in various cellular processes. This antibody recognizes and binds to the TRKB receptor, leading to its activation and subsequent signaling cascades. The TRKB antibody has been extensively studied in the field of life sciences and has shown promising results in adipocyte activation and adipose tissue regulation. Additionally, it has been shown to modulate the expression of E-cadherin, an important protein involved in cell adhesion. The glycan structure of this antibody contributes to its stability and enhances its binding affinity to its target. With its unique properties, the TRKB antibody is a valuable tool for researchers studying cellular signaling pathways and exploring therapeutic interventions.NNT antibody
NNT antibody was raised using the N terminal of NNT corresponding to a region with amino acids IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMDegré de pureté :Min. 95%MMB-4
CAS :MMB-4 is an oxime drug that is used as an anthelmintic. It has a low potency and body formation, which is thought to be due to its pyridinium group. MMB-4 has been shown to have both anthelmintic and antihelminthic effects in mice, as well as being effective against a number of parasites in vitro. MMB-4 has also been shown to have no effect on the human serum at physiological levels, but can cause serious side effects when taken at higher concentrations. The cyclic peptide MMB-4 was synthesized by chemical methods from indirubin, which is a natural product found in plants. In the study, it was shown that the reaction mechanism for MMB-4 involves the formation of a free radical intermediate with oxygen. This intermediate then reacts with other molecules to form covalent bonds. MMB-4 can be used for analytical purposes due to its stability and reactFormule :C13H14Br2N4O2Degré de pureté :Min. 95%Masse moléculaire :418.08 g/molCytokeratin 19 antibody
Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids TSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARSFPI1 antibody
SFPI1 antibody was raised in rabbit using the N terminal of SFPI1 as the immunogenDegré de pureté :Min. 95%MEGF9 antibody
The MEGF9 antibody is a highly effective inhibitor that is widely used in various assays and research studies in the field of Life Sciences. This antibody targets MEGF9, a glycoprotein that plays a crucial role in cellular processes such as telomerase activity and methyl transferase activity. By specifically binding to MEGF9, this antibody effectively blocks its function, making it an invaluable tool for studying the mechanisms of these important cellular processes.N-[8-[[(3S)-4-(Cyclopentylcarbonyl)-3-methyl-1-piperazinyl]methyl]-7-methylimidazo[1,2-a]pyridin-6-yl]-2-methyl-5-pyrimidinecarboxam ide
CAS :N-[8-[[(3S)-4-(Cyclopentylcarbonyl)-3-methyl-1-piperazinyl]methyl]-7-methylimidazo[1,2-a]pyridin-6-yl]-2-methyl-5-pyrimidinecarboxam ide is a peptide that activates ion channels and inhibits protein interactions. It is used as a research tool in the fields of cell biology, pharmacology, and immunology. This peptide is an inhibitor for the receptor for the neurotransmitter acetylcholine. It has been shown to be a ligand for the nicotinic acetylcholine receptor alpha subunit and can also inhibit protein interactions with other proteins.Formule :C26H33N7O2Degré de pureté :Min. 95%Masse moléculaire :475.6 g/molZFP90 antibody
ZFP90 antibody was raised in rabbit using the middle region of ZFP90 as the immunogen
Degré de pureté :Min. 95%LRCH4 antibody
LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLMTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVPDegré de pureté :Min. 95%Carboxyl Ester Lipase antibody
Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRDegré de pureté :Min. 95%SFRS11 antibody
SFRS11 antibody was raised using the C terminal of SFRS11 corresponding to a region with amino acids KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIETAZD 5363
CAS :AZD 5363, also called Capivasertib, inhibits AKT1, AKT2, AKT3, P70S6K and PKA. A pyrrolopyrimidine derivative with antineoplastic activity.Formule :C21H25ClN6O2Degré de pureté :Min. 95%Masse moléculaire :428.92 g/molIFN Alpha 5 antibody
IFN Alpha 5 antibody was raised using the middle region of IFNA5 corresponding to a region with amino acids TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYDegré de pureté :Min. 95%Mouse Transferrin antibody
Affinity purified Goat polyclonal Mouse Transferrin antibodyDegré de pureté :Min. 95%
![N-[8-[[(3S)-4-(Cyclopentylcarbonyl)-3-methyl-1-piperazinyl]methyl]-7-methylimidazo[1,2-a]pyridin-6…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FEID89279.webp&w=3840&q=75)
