Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.014 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
IFN beta antibody
IFN beta antibody was raised in mouse using human interferon beta as the immunogen.TSPYL6 antibody
TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFPZFP106 antibody
ZFP106 antibody was raised in rabbit using the N terminal of ZFP106 as the immunogenDegré de pureté :Min. 95%HTR5A antibody
HTR5A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%POLR2J2 protein (His tag)
Purified recombinant Human POLR2J2 protein (His tag)Degré de pureté :Min. 95%PNPO antibody
PNPO antibody was raised using the N terminal of PNPO corresponding to a region with amino acids PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATPKC delta antibody
The PKC delta antibody is a highly specific and potent tool used in life sciences research. It targets the protein kinase C delta, an enzyme involved in various cellular processes such as glucose transporter activation and growth factor signaling. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific experimental needs.Degré de pureté :Min. 95%APLNR antibody
The APLNR antibody is a monoclonal antibody that targets the apelin receptor (APLNR). It is commonly used in Life Sciences research for various applications. This antibody specifically binds to APLNR expressed on mesenchymal stem cells and MCF-7 cells, making it a valuable tool for studying the role of APLNR in cell signaling pathways and cellular processes. Additionally, the APLNR antibody can be used in combination with other antibodies, such as anti-CD33 antibody, to investigate complex protein interactions and signaling cascades. Its colloidal nature allows for easy conjugation with fluorescent dyes or enzymes for visualization and detection purposes. With its high specificity and affinity towards APLNR, this monoclonal antibody provides researchers with a reliable tool to explore the functions of this receptor in growth factor signaling, kinase inhibition, collagen activation, fatty acid metabolism, and other related areas of study.
Survivin antibody (Thr34)
Synthetic human survivin phosphopeptide (Thr34) immunogen; rabbit Polyclonal Survivin antibody (Thr34)
MCM4 antibody
MCM4 antibody was raised using the C terminal of MCM4 corresponding to a region with amino acids KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL
Pebp1 protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high activity on human erythrocytes using a patch-clamp technique. Metabolically, it undergoes various transformations like hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.Degré de pureté :Min. 95%C1S antibody
The C1S antibody is a powerful tool used in the field of Life Sciences for ultrasensitive detection of IL-17A. This antibody is a nucleic acid aptamer that exhibits high specificity and affinity for IL-17A, making it an ideal choice for various applications. The C1S antibody can be used in colloidal or electrochemical biosensing platforms to detect IL-17A levels with exceptional accuracy and sensitivity.CK19 antibody
The CK19 antibody is a monoclonal antibody that specifically targets the pluripotent stem cell marker CK19. It is commonly used in research and diagnostic applications to identify and isolate CK19-positive cells. This antibody has been shown to have immunomodulatory effects, inducing apoptosis in CK19-expressing cells. The CK19 antibody can be used in various techniques such as immunohistochemistry, flow cytometry analysis, and Western blotting. It is a valuable tool for studying the role of CK19 in development, disease progression, and therapeutic applications. With its high specificity and sensitivity, the CK19 antibody provides reliable results in both basic research and clinical settings.
Human Growth Hormone antibody
Human growth hormone antibody was raised in rabbit using hGH as the immunogen.Degré de pureté :Min. 95%POU5F1 antibody
The POU5F1 antibody is a mouse monoclonal antibody that has the potential to serve as a biomarker in various Life Sciences applications. It specifically targets the POU5F1 protein, also known as Oct-4, which plays a crucial role in maintaining pluripotency and self-renewal of stem cells. This antibody can be used for hybridization studies, such as immunofluorescence or immunohistochemistry, to detect the presence and localization of POU5F1 in primary cells or pluripotent stem cells.CA12 antibody
The CA12 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is commonly used in research and diagnostic applications, particularly in electrophoresis experiments. This antibody specifically targets and binds to CA12, a protein that plays a crucial role in various biological processes.Oct4 antibody
The Oct4 antibody is a highly specialized monoclonal antibody that is used for ultrasensitive detection of the octamer-binding transcription factor. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting Oct4 in various samples, including human serum and pluripotent cells. It can be used in a variety of research applications, including immunohistochemistry, Western blotting, and flow cytometry.Glutamate Pyruvate Transaminase protein (Porcine)
Purified native Porcine Glutamate Pyruvate Transaminase protein
Degré de pureté :Min. 95%FLI1 antibody
The FLI1 antibody is a highly specialized antibody that is designed to target and bind to the FLI1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting activated FLI1 in human serum samples.Hspb7 antibody
Hspb7 antibody was raised in rabbit using the middle region of Hspb7 as the immunogenDegré de pureté :Min. 95%Beta Lactamase Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LACTB antibody, catalog no. 70R-2442Degré de pureté :Min. 95%alpha Synuclein A53T protein
MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVTTVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEADegré de pureté :Min. 95%EBI3 antibody
EBI3 antibody was raised using the middle region of EBI3 corresponding to a region with amino acids TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPSLC4A2 antibody
SLC4A2 antibody was raised using the N terminal of SLC4A2 corresponding to a region with amino acids MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEIDegré de pureté :Min. 95%C4BPB antibody
C4BPB antibody was raised using the N terminal of C4BPB corresponding to a region with amino acids CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV
Degré de pureté :Min. 95%RBMS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBMS1 antibody, catalog no. 70R-1624Degré de pureté :Min. 95%PDE7B antibody
PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%RBP4 antibody
RBP4 antibody was raised in mouse using recombinant human RBP4 (19-201aa) purified from E. coli as the immunogen.BID antibody
BID antibody was raised in mouse using recombinant human BID (1-195aa) purified from E. coli as the immunogen.TNF alpha antibody
TNF alpha antibody is a specific antibody that targets tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. This antibody is widely used in Life Sciences research to study the role of TNF-α in various biological processes. It can be used for applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry.MMP1 antibody
The MMP1 antibody is a polyclonal antibody commonly used in life sciences research. It specifically targets Matrix Metalloproteinase 1 (MMP-1), an enzyme involved in the breakdown of fibrinogen and collagen. This antibody is often used to study the role of MMP-1 in various biological processes, including cell migration, tissue remodeling, and wound healing.ZNF607 antibody
ZNF607 antibody was raised in rabbit using the middle region of ZNF607 as the immunogenDegré de pureté :Min. 95%DGKA antibody
The DGKA antibody is a highly specialized immunohistochemistry product designed for Life Sciences research. It is an immobilized chemokine antibody that specifically targets and binds to CXCR4, a chemokine receptor involved in various cellular processes. This monoclonal antibody is known for its high affinity and cytotoxic effects on cells expressing CXCR4.BSA (Protease free)
CAS :Protease free Bovine Serum AlbuminDegré de pureté :>99% Albumin By ElectrophoresisA2BP1 antibody
A2BP1 antibody was raised in rabbit using the N terminal of A2BP1 as the immunogenDegré de pureté :Min. 95%COPZ1 antibody
The COPZ1 antibody is a highly specialized antibody that targets epidermal growth factor (EGF) and its related molecules. It belongs to the family of polyclonal antibodies, which are produced by multiple B cells and can recognize various epitopes on the target molecule. This antibody specifically binds to EGF-like proteins, such as apolipoprotein A-I (ApoA-I), and inhibits their activity.Calsyntenin 3 antibody
Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRADegré de pureté :Min. 95%AK3L1 antibody
AK3L1 antibody was raised using the N terminal of AK3L1 corresponding to a region with amino acids MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEV
CYP3A1 antibody
CYP3A1 antibody was raised in rabbit using a synthetic peptide as the immunogen.Degré de pureté :Min. 95%MLF1 antibody
The MLF1 antibody is a therapeutically important protein inhibitor that targets nucleotide element binding proteins. This antibody is designed to specifically bind to MLF1, a protein involved in various cellular processes. By inhibiting the activity of MLF1, this antibody can potentially regulate gene expression and cellular functions. The MLF1 antibody is highly specific and can be used in various life science research applications. It is commonly used in studies involving protein-protein interactions, signal transduction pathways, and gene regulation. With its high affinity and specificity, this antibody offers researchers a valuable tool for understanding the role of MLF1 in cellular processes.SIRT7 antibody
SIRT7 antibody was raised in rabbit using the middle region of SIRT7 as the immunogen
Degré de pureté :Min. 95%Clostridium difficile Toxoid A protein
Purified Native Clostridium difficile Toxoid A proteinDegré de pureté :Min. 95%MTHFR antibody
The MTHFR antibody is a monoclonal antibody used in the field of life sciences. It is designed to target and bind to the enzyme methylenetetrahydrofolate reductase (MTHFR). This antibody is commonly used in various research applications, including hybridization studies, where it can be used to detect and visualize the presence of MTHFR in biological samples.SIN3A antibody
SIN3A antibody was raised in rabbit using the N terminal of SIN3A as the immunogenDegré de pureté :Min. 95%SIL1 antibody
SIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAKDegré de pureté :Min. 95%Twist 1 antibody
The Twist 1 antibody is a polyclonal antibody that has neutralizing properties against the growth factor Twist 1. This antibody specifically targets and inhibits the activity of Twist 1, a transcription factor involved in cell differentiation and embryonic development. By blocking the function of Twist 1, this antibody can prevent abnormal cell growth and promote normal cellular processes.Degré de pureté :Min. 95%4,4'-Methylenebis(5-methyl-1H-pyrrole-2-carbaldehyde)
CAS :4,4'-Methylenebis(5-methyl-1H-pyrrole-2-carbaldehyde) is a ligand that binds to the GABAA receptor. It has been shown to activate this receptor by binding to the alpha subunit of the GABAAR. This receptor is responsible for mediating inhibitory signals in the brain. Activation of this receptor leads to an increase in chloride ion influx, which causes hyperpolarization of neurons and thus reduces neuronal activity. 4,4'-Methylenebis(5-methyl-1H-pyrrole-2-carbaldehyde) has also been shown to be a competitive inhibitor of peptides that bind to the GABAA receptor, such as baclofen and muscimol.
!--END-->Formule :C13H14N2O2Degré de pureté :Min. 95%Masse moléculaire :230.26 g/molSIAH1 antibody
The SIAH1 antibody is a highly specialized antibody that targets the phosphatase histidine. It exhibits cytotoxic properties and is commonly used in multidrug treatments. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. It has been extensively used in various life sciences applications, including ophthalmic formulations, chemokine studies, hybridization assays, growth factor research, and immunoassays. The SIAH1 antibody is known for its high specificity and sensitivity, making it a valuable tool for scientists studying cellular signaling pathways and protein regulation. Whether you're conducting basic research or developing new therapeutic approaches, this antibody is an essential component of your toolkit.p53 antibody
p53 antibody was raised in mouse using recombinant human p53 (transcription domain within the NH2 terminus) as the immunogen.ITGB3 antibody
ITGB3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%SNX27 antibody
The SNX27 antibody is a highly effective monoclonal antibody used in Life Sciences. It is specifically designed to target thrombocytopenia, a condition characterized by low platelet count. This powerful antibody works by binding to specific receptors on the surface of platelets, promoting their activation and preventing their destruction. In addition to its role in treating thrombocytopenia, the SNX27 antibody has also shown promise in other areas of research. It can be used in assays to detect and quantify various proteins, such as collagen and anti-mesothelin antibodies. Furthermore, this antibody has been found to inhibit the activity of urokinase plasminogen activator, an enzyme involved in blood clot dissolution. With its cytotoxic properties and ability to neutralize inhibitors present in human serum, the SNX27 antibody is a valuable tool for both laboratory research and therapeutic applications.EWSR1 antibody
EWSR1 antibody was raised in rabbit using the middle region of EWSR1 as the immunogenDegré de pureté :Min. 95%NUMB antibody
The NUMB antibody is a monoclonal antibody that specifically targets adiponectin, a growth factor found in adipose tissue. This antibody is widely used in Life Sciences research to study the role of adiponectin in various physiological processes. It has been shown to be effective in detecting and quantifying adiponectin levels in samples such as serum, plasma, and cell lysates. The NUMB antibody can also be used for immunohistochemistry and Western blot analysis to visualize the expression of adiponectin in different tissues. Additionally, this antibody has been used to investigate the presence of autoantibodies against adiponectin in certain diseases, including insulin resistance and diabetes. Its high specificity and sensitivity make it a valuable tool for researchers studying adipocyte biology and related disorders.RABEP1 antibody
The RABEP1 antibody is a polyclonal antibody that has high specificity for interferon and alpha-fetoprotein. It recognizes specific glycan and fatty acid molecules and can be used in various applications in the field of Life Sciences. This monoclonal antibody exhibits high specific activity, making it a valuable tool for research purposes. It can be used to detect the presence of RABEP1 protein in samples such as human serum or cell lysates. Additionally, this antibody has been shown to have superoxide activity and may play a role in regulating lipoprotein lipase activity. With its versatility and reliability, the RABEP1 antibody is an essential component for any laboratory conducting research in these areas.PGM2L1 antibody
PGM2L1 antibody was raised using the N terminal of PGM2L1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLKLPCAT1 antibody
LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFDegré de pureté :Min. 95%PIK3R4 antibody
PIK3R4 antibody was raised using the N terminal of PIK3R4 corresponding to a region with amino acids HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLDegré de pureté :Min. 95%SLITRK6 antibody
SLITRK6 antibody was raised using the N terminal of SLITRK6 corresponding to a region with amino acids NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL
Degré de pureté :Min. 95%BCL2 antibody
The BCL2 antibody is a highly specialized monoclonal antibody that targets the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell survival. This antibody specifically binds to the BCL2 protein, inhibiting its function and promoting apoptosis (cell death) in cancer cells.DPH2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DPH2 antibody, catalog no. 70R-3317Degré de pureté :Min. 95%PYGB antibody
PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT
Rex1 antibody
The Rex1 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used in assays and immunohistochemical studies to detect the presence of Rex1, a protein expressed in pluripotent stem cells. This antibody has been shown to be highly specific and sensitive, making it an ideal tool for studying the properties and behavior of stem cells. Additionally, the Rex1 antibody can be used as an inhibitor to block the activity of Rex1, allowing researchers to investigate its function and role in cellular processes. Its application extends beyond basic research, as it has potential uses in the development of new medicines and therapies targeting pluripotent stem cells. With its unique ability to recognize and bind to Rex1, this antibody offers valuable insights into the complex mechanisms underlying cell differentiation and development.Degré de pureté :Min. 95%ATXN7 antibody
ATXN7 antibody was raised in rabbit using the middle region of ATXN7 as the immunogenDegré de pureté :Min. 95%Binapacryl
CAS :Produit contrôléBinapacryl is a chemical compound classified as an acaricide and fungicide. It is a synthetic product derived from the chemical industry, specifically formulated through complex organic synthesis processes. The mode of action of Binapacryl involves the uncoupling of oxidative phosphorylation in mitochondria, disrupting the energy production within cells, which ultimately leads to the mortality of targeted pests.Formule :C15H18N2O6Degré de pureté :Min. 95%Masse moléculaire :322.31 g/molZIC4 antibody
The ZIC4 antibody is a highly specialized medicament that targets specific autoantibodies in the body. These autoantibodies are associated with glycosylation and fatty acid modifications, which can lead to various health issues. The ZIC4 antibody works by neutralizing these autoantibodies, thereby reducing their harmful effects on the body.CA 19-9 antibody
The CA 19-9 antibody is a monoclonal antibody that specifically targets the CA 19-9 antigen. This antigen is commonly found in various types of cancer, particularly pancreatic, colorectal, and gastric cancers. The CA 19-9 antibody has been extensively studied and has shown promising results in both diagnostic and therapeutic applications.LYVE1 antibody
LYVE1 antibody was raised in mouse using recombinant human LYVE-1 (25-235 aa) purified from E. coli as the immunogen.VCAM1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and is highly effective in inhibiting bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. The active form of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
