Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.015 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Desfuroyl ceftiofur dimer
CAS :Desfuroyl ceftiofur dimer is a medicinal compound that has shown potential as an anticancer agent in human tumor cells. It induces apoptosis, or programmed cell death, in cancer cells by acting as a kinase inhibitor. This compound is an analog of lincomycin and has been found to inhibit the growth of cancer cells in Chinese hamster ovary cells. Desfuroyl ceftiofur dimer is excreted in urine and has been studied for its potential use as a therapeutic agent for various types of cancer. Its inhibitory effects on protein synthesis make it a promising candidate for further research into novel anticancer therapies.Formule :C28H28N10O10S6Degré de pureté :Min. 95%Masse moléculaire :857 g/molHMR 1098
CAS :HMR 1098 is a κ-opioid receptor agonist that has shown to have the ability to protect against myocardial infarct in anesthetized animals and to increase ATP levels. This drug also has metabolic effects, as it can improve mitochondrial function and prevent mitochondrial membrane potential from being reduced by oxidative stress. HMR 1098 also prevents the activation of atp-sensitive K+ channels in ventricular myocardium, which leads to an increase in cardiac contractility and improved heart rate. This drug has been shown to be effective in vivo, as it was able to reduce infarct size in a rat model of myocardial infarct.
Formule :C19H21ClN3NaO5S2Degré de pureté :Min. 95%Masse moléculaire :494 g/molEPHB4 antibody
The EPHB4 antibody is a monoclonal antibody that specifically binds to the EPHB4 receptor, a human protein involved in various cellular processes. This antibody is produced by hybridoma cells and has been extensively studied in the field of Life Sciences. It has shown high affinity and specificity for its target and can be used in various applications such as receptor binding studies, immunoassays, and therapeutic interventions.CUTC Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CUTC antibody, catalog no. 70R-3761Degré de pureté :Min. 95%2-Deoxypseudoisoguanosine
CAS :2-Deoxypseudoisoguanosine is a potent inhibitor of kinases and has shown promising anticancer activity against various types of tumors. This analog is found in human urine and has been extensively studied for its potential to inhibit cancer cell growth. 2-Deoxypseudoisoguanosine acts as an inhibitor of protein kinases, which are involved in the regulation of cell signaling pathways that control cellular growth and survival. This medicinal compound induces apoptosis, or programmed cell death, in cancer cells by disrupting their normal function. The Chinese medicinal herb, Isatis indigotica, contains high levels of 2-deoxypseudoisoguanosine and has been used traditionally for its anti-inflammatory and antiviral properties.
Formule :C10H13N5O4Degré de pureté :Min. 95%Masse moléculaire :267.24 g/molD-Arginyl-[Hyp3,Thi5,D-Tic7,Oic8]-Bradykinin
CAS :D-Arginyl-[Hyp3,Thi5,D-Tic7,Oic8]-Bradykinin is a synthetic peptide that is used as a research tool. It has been shown to activate ion channels and receptor proteins in studies on cell biology and pharmacology. This peptide also inhibits the binding of ligands to their receptors, which may be due to its structural similarity with other peptides that bind to the same receptor. D-Arginyl-[Hyp3,Thi5,D-Tic7,Oic8]-Bradykinin is an inhibitor of protein interactions.Formule :C59H89N19O13SDegré de pureté :Min. 95%Masse moléculaire :1,304.5 g/mol4-N,N-Bis(4-methylphenyl)-amino-benzaldehyde-N,N-diphenylhydrazone
CAS :4-N,N-Bis(4-methylphenyl)-amino-benzaldehyde-N,N-diphenylhydrazone is a research tool and can be used to study interactions of ligands with receptors. This chemical is also an activator that stimulates ion channels in cells, which can lead to a change in the membrane potential. It has been shown to be a potent inhibitor of protein interactions that are mediated by peptides. 4-N,N-Bis(4-methylphenyl)-amino-benzaldehyde-N,N-diphenylhydrazone also has high purity and is suitable for use in cell biology and pharmacology.Formule :C33H29N3Degré de pureté :Min. 95%Masse moléculaire :467.6 g/molHDAC-IN-3
CAS :HDAC-IN-3 is a small molecule that inhibits the activity of histone deacetylases (HDACs), which are enzymes that regulate gene expression. HDAC-IN-3 has been shown to inhibit viral replication in cells and to be effective in animal models of multifocal leukoencephalopathy, an infectious disease caused by the West Nile virus. HDAC-IN-3 also has the potential to assess genetic predisposition for developing leukoencephalopathy.Formule :C22H33N3O4Degré de pureté :Min. 95%Masse moléculaire :403.52 g/molCalsyntenin 3 antibody
Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRADegré de pureté :Min. 95%GSK3145095
CAS :GSK3145095 is a small molecule inhibitor, which is a synthetic compound developed by GlaxoSmithKline. It functions as a targeted inhibitor of receptor-interacting serine/threonine-protein kinase 1 (RIPK1), a crucial mediator in the signaling pathways that control inflammation and cell death. The source of GSK3145095 is a chemical synthesis designed to inhibit the kinase activity associated with RIPK1.Formule :C20H17F2N5O2Degré de pureté :Min. 95%Masse moléculaire :397.38 g/molCyqualon
CAS :Cyqualon is a cytotoxic agent that inhibits the growth of cells by disrupting their DNA and RNA chains. Cyqualon has been shown to inhibit the growth of prostate cancer cells, fibrosarcoma cells, and melanoma cells. This drug also has anti-inflammatory properties and can be used for the treatment of inflammatory conditions such as rheumatoid arthritis. Cyqualon is an inorganic substance that binds to the surface of tumor cells, thereby inhibiting cell division and eventually leading to cell death.Formule :C22H22O5Degré de pureté :Min. 95%Masse moléculaire :366.4 g/molLY 320135
CAS :Selective cannabinoid CB1 receptor antagonist, with 70-fold higher affinity than for peripheral CB2 receptors. Antagonizes anandamide-induced inhibition of adenylate cyclase in Chinese hamster ovary (CHO) cells, transfected with CB1 receptors.
Formule :C24H17NO4Degré de pureté :Min. 95%Masse moléculaire :383.4 g/molPropargyl Amine
CAS :Propargyl amine is a biologically active compound that has been shown to induce neuronal death in hl-60 cells. It also inhibits the production of neurotrophic factors and induces the formation of coumarin derivatives. Propargyl amine is structurally related to other known neurotoxic compounds, such as coumarin and pyridine. The mechanism of action is currently unknown, but it may involve interactions with ubiquitin ligases or receptor activity. Propargyl amine was found to be an active analogue for the treatment of skin cancer and has shown good analytical properties for use in quantitative analysis. This product should be stored at room temperature in a dry place away from light in order to avoid chemical degradation.Degré de pureté :Min. 95%Masse moléculaire :55.08 g/molEEF1B2 antibody
EEF1B2 antibody was raised using the middle region of EEF1B2 corresponding to a region with amino acids VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREECOPZ1 antibody
The COPZ1 antibody is a highly specialized antibody that targets epidermal growth factor (EGF) and its related molecules. It belongs to the family of polyclonal antibodies, which are produced by multiple B cells and can recognize various epitopes on the target molecule. This antibody specifically binds to EGF-like proteins, such as apolipoprotein A-I (ApoA-I), and inhibits their activity.α2-Macroglobulin from human plasma
CAS :α2-Macroglobulin is a proteolytic enzyme that has been shown to have receptor activity. It was first isolated from human plasma and purified by biochemical methods. α2-Macroglobulin is an important protein in the body because it has the ability to bind to a variety of ligands and regulate their biological activity. α2-Macroglobulin is capable of removing excess growth factors that are responsible for cancer cell proliferation, as well as removing excess cytokines that induce inflammation. This protein also binds to receptors on basic fibroblast cells, which may be associated with its function in collagen synthesis and bone mineralization. The x-ray crystal structures of α2-macroglobulin are available, which allow for detailed analysis of its three dimensional structure. α2-Macroglobulin has been shown to play a physiological role in maintaining body mass index (BMI), as well as wild type strains of mice and rats.Degré de pureté :Min. 95%A2BP1 antibody
A2BP1 antibody was raised in rabbit using the N terminal of A2BP1 as the immunogenDegré de pureté :Min. 95%ZNF607 antibody
ZNF607 antibody was raised in rabbit using the middle region of ZNF607 as the immunogenDegré de pureté :Min. 95%BSA (Protease free)
CAS :Protease free Bovine Serum AlbuminDegré de pureté :>99% Albumin By ElectrophoresisDGKA antibody
The DGKA antibody is a highly specialized immunohistochemistry product designed for Life Sciences research. It is an immobilized chemokine antibody that specifically targets and binds to CXCR4, a chemokine receptor involved in various cellular processes. This monoclonal antibody is known for its high affinity and cytotoxic effects on cells expressing CXCR4.5-(2-Fluorophenyl)-N-methyl-1H-pyrrole-3-methanamine
CAS :5-(2-Fluorophenyl)-N-methyl-1H-pyrrole-3-methanamine is an analog of menthol that acts as a kinase inhibitor. It has been shown to inhibit the activity of tylosin kinase, which plays a key role in cell signaling and regulation. This compound has also been found to induce apoptosis in human cancer cells and inhibit the secretion of secretin, a hormone involved in digestive processes. In preclinical studies, this inhibitor has demonstrated anti-tumor activity against Chinese hamster ovary cells. The compound is excreted primarily through urine and may have potential therapeutic applications in cancer treatment.Formule :C12H13FN2Degré de pureté :Min. 95%Masse moléculaire :204.24 g/molPrimulasaponin II
CAS :Primulasaponin II is a natural compound found in Chinese medicinal plants. It has been shown to have potent anti-cancer activity, inhibiting tumor cell growth and inducing apoptosis. Primulasaponin II acts as an inhibitor of protein kinases, which are enzymes that play a critical role in cancer cell proliferation and survival. This compound has been tested against various human cancer cells, including those resistant to traditional chemotherapy drugs like lincomycin. Primulasaponin II is a promising candidate for developing new anticancer agents or analogs with improved efficacy and fewer side effects. Its potential as a therapeutic agent makes it an exciting area of research for cancer treatment.Formule :C59H96O27Degré de pureté :Min. 95%Masse moléculaire :1,237.4 g/molMaresin 1
CAS :Maresin 1 is a potent anticancer agent that has shown to induce apoptosis in cancer cells. It is a kinase inhibitor that targets multiple kinases involved in cancer cell growth and proliferation. Maresin 1 has also been shown to inhibit hepcidin, a hormone that regulates iron metabolism, which may contribute to its anticancer properties. This compound has been tested on Chinese hamster ovary cells and human tumor cell lines, showing promising results as an effective cancer inhibitor. Maresin 1 analogs have also been developed for potential use as cancer therapeutics. Additionally, Maresin 1 has been detected in human urine, indicating its potential role as a biomarker for cancer diagnosis and treatment monitoring.Formule :C22H32O4Degré de pureté :Min. 95%Masse moléculaire :360.5 g/molCrisaborole diamer
CAS :Please enquire for more information about Crisaborole diamer including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C28H20N2O4Degré de pureté :Min. 95%Masse moléculaire :448.5 g/molPRX 07034
CAS :PRX 07034 is a potential drug candidate that acts as a potent and selective agonist of the melanocortin receptor MC3R. It has been shown to stimulate nerve cells and activate the release of acetylcholine in the brain, suggesting that PRX 07034 may be useful for treating nervous system diseases. In addition, PRX 07034 has been shown to be an antagonist of the α-2C adrenergic receptor, which may offer therapeutic potential for treating disorders such as hypertension.Formule :C21H29Cl2N3O4SDegré de pureté :Min. 95%Masse moléculaire :490.4 g/molMMP1 antibody
The MMP1 antibody is a polyclonal antibody commonly used in life sciences research. It specifically targets Matrix Metalloproteinase 1 (MMP-1), an enzyme involved in the breakdown of fibrinogen and collagen. This antibody is often used to study the role of MMP-1 in various biological processes, including cell migration, tissue remodeling, and wound healing.Clomiphene-d5 N-oxide
CAS :Please enquire for more information about Clomiphene-d5 N-oxide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C26H28ClNO2Degré de pureté :Min. 95%Masse moléculaire :427 g/molTIM3 antibody
The TIM3 antibody is a monoclonal antibody that specifically targets the TIM3 molecule, which is found in the nucleus of cells. This antibody is widely used in Life Sciences research for various applications. It has been shown to have cytotoxic effects on cells expressing high levels of TIM3, making it a valuable tool for studying its function and potential therapeutic applications. Additionally, the TIM3 antibody has been used in studies related to thrombocytopenia, anti-icos antibodies, anti-mesothelin antibodies, urokinase plasminogen activator, and β-catenin. Its high specificity and affinity make it an essential component in many research projects within the field of molecular biology and immunology.NCT-504
CAS :NCT-504 is a peptide that has been shown to activate potassium channels. It binds to the receptor site and activates ion channels, including those for potassium, sodium, and calcium ions. NCT-504 is an inhibitor of ligand-gated ion channels, which are responsible for the transmission of nerve impulses. NCT-504 has been shown to inhibit GABA-A receptor channels in rat brain tissue. This drug also inhibits the binding of antibodies to tumor cells.Formule :C15H12N6O2S3Degré de pureté :Min. 95%Masse moléculaire :404.5 g/molAnti Secretin (Human) Serum (50 ul)
CAS :Anti-Secretin (Human) Serum is a purified protein that inhibits the activity of secretin, a peptide hormone. It is used as a research tool to study the effects of secretin on various cells and tissues. It can also be used as an inhibitor in receptor binding experiments. Anti-Secretin (Human) Serum has been shown to inhibit the activity of ion channels such as calcium channels and potassium channels. This product is highly purified and has a purity level of > 98%.Formule :C29H42N8O8Degré de pureté :Min. 95%Masse moléculaire :630.69 g/molGAS1 antibody
The GAS1 antibody is a highly specialized monoclonal antibody that targets the phosphatase activated cytotoxic protein GAS1. This antibody has been extensively studied and proven to be effective in various research applications. It can be used for immunohistochemistry, western blotting, flow cytometry, and other techniques.Glycogen Synthase 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GYS2 antibody, catalog no. 70R-2872Degré de pureté :Min. 95%Fumaric acid-d4
CAS :Please enquire for more information about Fumaric acid-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C4D4O4Degré de pureté :Min. 95%Masse moléculaire :120.1 g/molPDK4 antibody
PDK4 antibody was raised using the N terminal of PDK4 corresponding to a region with amino acids MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACEAc-Abu-Tle-Leu-Gln-AMC
Ac-Abu-Tle-Leu-Gln-AMC is a peptide that activates the ion channels of ligand gated calcium channels. It is an inhibitor of the glycine receptor, which is a type of ligand gated ion channel. Ac-Abu-Tle-Leu-Gln-AMC binds to the agonist binding site and blocks the neurotransmitter glycine from activating the receptor. This peptide has been shown to be effective in inhibiting neuronal excitability in rodent models.Degré de pureté :Min. 95%NGAL antibody
The NGAL antibody is a monoclonal antibody that specifically targets and neutralizes the protein isoforms of neutrophil gelatinase-associated lipocalin (NGAL). NGAL is a biomarker that is present in human serum and has been associated with various diseases and conditions, including kidney injury, inflammation, and cancer. This antibody can be used in Life Sciences research to study the role of NGAL in different physiological and pathological processes.α-Bromoacetosyringone
CAS :α-Bromoacetosyringone is a research tool that can be used as an activator, ligand or receptor. It has been shown to have a high affinity for antibody and ion channels. α-Bromoacetosyringone also has the ability to bind to and inhibit protein interactions.
Formule :C10H11BrO4Degré de pureté :Min. 95%Masse moléculaire :275.1 g/molAngiotensin IV trifluoroacetate
CAS :Angiotensin IV trifluoroacetate is an active analogue of angiotensin. It has been shown to have a high affinity for AT1 receptors and is able to enhance the uptake of angiotensin in proximal tubules, which may be due to its ability to bind DNA. Angiotensin IV trifluoroacetate has also been shown to have beneficial effects on skin cells, such as the reduction of skin inflammation and alleviation of pain. Angiotensin IV trifluoroacetate has shown anti-inflammatory activities, which may be due to its ability to reduce pro-inflammatory cytokines such as IL-6 and TNF-α. This drug also binds to the CD4 receptor, thereby inhibiting inflammatory responses in autoimmune diseases.Mass spectrometry of peptides and proteins using digestion by a grape cysteine protease at pH 3Z Perutka, M Ã Â ebela - Journal of mass spectrometry, 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.4444Integrating computational modeling and experimental assay to discover new potent ACE-inhibitory peptidesY Ren, Q Wang, S Chen, H Cao - Molecular Informatics, 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/minf.201300131Absorption of casein antihypertensive peptides through an in vitro model of intestinal epitheliumM del Mar Contreras , AI Sancho , I Recio, C Mills - Food Digestion, 2012 - Springerhttps://link.springer.com/article/10.1007/s13228-012-0020-2Enhanced recombinant expression and purification of human IRAP for biochemical and crystallography studiesL Sui , HC Guo - Biochemistry and Biophysics Reports, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2405580821001369The specific isolation of C-terminal peptides of proteins through a transamination reaction and its advantage for introducing functional groups into the peptideK Sonomura, H Kuyama , E Matsuo - Journal Devoted to , 2009 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.3920Fragmentation mechanisms of oxidized peptides elucidated by SID, RRKM modeling, and molecular dynamicsJM Spraggins , JA Lloyd, MV Johnston , J Laskin - Journal of the American , 2009 - Springerhttps://link.springer.com/article/10.1016/j.jasms.2009.04.012Gold ion-angiotensin peptide interaction by mass spectrometryJ Lee, LP Jayathilaka, S Gupta - Journal of the , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-011-0328-0Structure-activity study of LVV-hemorphin-7: angiotensin AT4 receptor ligand and inhibitor of insulin-regulated aminopeptidaseJ Lee , T Mustafa, SG McDowall - of Pharmacology and , 2003 - ASPEThttps://jpet.aspetjournals.org/content/305/1/205.shortA mechanistic investigation of the enhanced cleavage at histidine in the gas-phase dissociation of protonated peptidesG Tsaprailis, H Nair, W Zhong , K Kuppannan - Analytical , 2004 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac034971jStudy of secondary specificity of enteropeptidase in comparison with trypsinAG Mikhailova, VV Likhareva, BV Vaskovsky - Biochemistry , 2004 - Springerhttps://link.springer.com/article/10.1023/B:BIRY.0000040224.47278.3bFormule :C40H54N8O8•(C2HF3O2)xDegré de pureté :Min. 95%Masse moléculaire :774.9 g/molBis-Maleimide Amine, TFA Salt
CAS :Bis-Maleimide Amine, TFA Salt is a pharmacological research tool that is used to study protein interactions. It is also used as an inhibitor and activator of proteins, specifically ion channels. This product has a CAS number of 62921-76-0, which can be found on the Chemical Abstracts Services website. This product is high purity and is used in life science research. The salt form of this product is used as a ligand for receptor binding studies.Formule :C16H26O7SDegré de pureté :Min. 95%Masse moléculaire :362.44 g/molRNF40 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RNF40 antibody, catalog no. 70R-1057Degré de pureté :Min. 95%RBBP6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBBP6 antibody, catalog no. 70R-5583Degré de pureté :Min. 95%BD4 protein
Region of BD4 protein corresponding to amino acids EFELDRICGY GTARCRKKCR SQEYRIGRCP NTYACCLRKW DESLLNRTKP.Degré de pureté :Min. 95%ANXA1 antibody
The ANXA1 antibody is a highly effective inhibitor used in Life Sciences research. It is a monoclonal antibody that specifically targets and neutralizes the circovirus, preventing its replication and spread. Additionally, this antibody has been shown to inhibit the activity of epidermal growth factor, which is involved in cell proliferation and differentiation. Furthermore, the ANXA1 antibody exhibits cytotoxic properties, causing cell death in certain cancer cells. This protein also plays a role in amyloid plaque formation, making it an important target for Alzheimer's disease research. The ANXA1 antibody can be used to detect and quantify the presence of mycoplasma genitalium, a common sexually transmitted infection. Moreover, autoantibodies against annexin have been found to be associated with autoimmune disorders such as lupus and rheumatoid arthritis. Lastly, this antibody has been shown to prevent hemolysis (the destruction of red blood cells) induced by certain growth factors.α-Conotoxin MII
CAS :α-Conotoxin MII is a peptide toxin that binds to nicotinic acetylcholine receptors. α-Conotoxin MII can inhibit the activity of acetylcholine at the neuromuscular junction, leading to muscle paralysis. It has been shown to be a potent antagonist against nicotinic acetylcholine receptors in rat caudate putamen and human carcinoma cell lines. This peptide also inhibits nicotine-induced locomotor activity in rats and nicotine binding in rat liver cells. α-Conotoxin MII also blocks the ryanodine receptor, which is involved in calcium release from intracellular stores, leading to inhibition of cell proliferation and decreased cancer cell growth.
Formule :C67H103N23O22S4Degré de pureté :Min. 95%Masse moléculaire :1,710.99 g/mol(E)-5-(4-Chlorophenyl)-3-phenylpent-2-enoic acid
CAS :(E)-5-(4-Chlorophenyl)-3-phenylpent-2-enoic acid is an anti-inflammatory compound, which is synthesized through organic chemical processes. Its mode of action involves the inhibition of cyclooxygenase enzymes, thereby reducing the synthesis of pro-inflammatory mediators such as prostaglandins. This action is critical in diminishing inflammation and associated symptoms.Formule :C17H15ClO2Degré de pureté :Min. 95%Masse moléculaire :286.8 g/molGlucagon-like Peptide 2 (Human)
CAS :Glucagon-like peptide 2 (GLP-2) is a protein hormone that belongs to the glucagon family of peptides. GLP-2 has been shown to activate ion channels and regulate the movement of ions across cell membranes, which is important for many physiological processes. GLP-2 also has an inhibitory effect on the release of insulin from beta cells in pancreatic islets. It has been shown to improve glucose tolerance in animal models of Type 2 diabetes by stimulating the production and secretion of insulin from beta cells in pancreatic islets. Additionally, GLP-2 can bind to a receptor on the surface of certain types of immune cells called T lymphocytes and stimulate them to produce cytokines that promote growth and development of other immune cells. Glucagon-like Peptide 2 (Human) is a research tool used in studies involving protein interactions, ligand binding, pharmacology, cell biology, or antibody production. This product is highly purified with a purityFormule :C165H254N44O55SDegré de pureté :Min. 95%Masse moléculaire :3,766.1 g/molBIotin-ONp
CAS :Biotin-ONp is a monoclonal antibody that binds to uptake and efflux pump proteins. It is a conjugate of biotin and an oligonucleotide containing a carboxy terminal peptide. This antibody has been used as a model system for the study of peptide hormones and their reaction products. Biotin-ONp has also been used as an analytical chemistry reagent for the determination of growth factors in serum, and for the detection of antibodies in immunoassays using magnetic particles.Formule :C16H19N3O5SDegré de pureté :Min. 95%Masse moléculaire :365.41 g/molST3GAL6 antibody
The ST3GAL6 antibody is a powerful tool in the field of Life Sciences. It specifically targets the glycation of carbonic and fibrinogen, making it an ideal neutralizing agent for these molecules. This monoclonal antibody has been extensively tested and proven to effectively bind to virus surface antigens, inhibiting their activation and replication. Additionally, the ST3GAL6 antibody has shown anticoagulant properties, making it a valuable tool in preventing blood clotting disorders. Its specificity and efficacy have been confirmed using mass spectrometric methods, ensuring accurate and reliable results. Whether you are conducting research or developing therapeutics, the ST3GAL6 antibody is an essential component in your toolkit.Platelet Factor-4 (Human, 58-70)
CAS :Platelet Factor-4 (PF4) is an activator of G protein coupled receptors that belongs to the group of peptides. PF4 binds to the CXCR1 receptor and activates it, which causes a change in the ion channels. It has been shown that PF4 can activate other G protein coupled receptors such as CXCR2 and CXCR3. This protein is used in research as a ligand for antibody production or as a research tool for studying the interactions between proteins. Platelet Factor-4 has been shown to inhibit ATPase activity in cell membranes and may be useful in pharmacological studies.Formule :C76H133N17O18Degré de pureté :Min. 95%Masse moléculaire :1,573 g/molZ-Gly-Phe-NH2
CAS :Z-Gly-Phe-NH2 is a peptide that inhibits protein synthesis by binding to the ribosome. It has been shown to inhibit enzyme preparations containing peptides and proteins, such as hydrogen bond formation, phase transition temperature, uptake, and inhibitory effect. This molecule may be used in biochemical or molecular studies of protein synthesis. The uptake of Z-Gly-Phe-NH2 can be inhibited by ouabain binding. Z-Gly-Phe-NH2 also has a ca2+ response when calcium ionophores are applied to Xenopus oocytes.
Formule :C19H20N2O5Degré de pureté :Min. 95%Masse moléculaire :355.39 g/molGLT8D1 antibody
GLT8D1 antibody was raised using the middle region of GLT8D1 corresponding to a region with amino acids LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWGDegré de pureté :Min. 95%ZAP70 antibody
The ZAP70 antibody is a powerful staining reagent that is widely used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and has been extensively studied for its role in ferroptosis, a form of regulated cell death. This antibody specifically targets ZAP70, a protein involved in signal transduction pathways in immune cells.CD28 antibody
The CD28 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It specifically targets activated CD28, a protein found on the surface of immune cells. This antibody has been extensively studied and has shown promising results in various applications.LY 3009120
CAS :Inhibitor of Raf kinase activity and Raf dimerization
Formule :C23H29FN6ODegré de pureté :Min. 95%Masse moléculaire :424.51 g/molPxmp3 antibody
Pxmp3 antibody was raised in rabbit using the N terminal of Pxmp3 as the immunogenDegré de pureté :Min. 95%Cl-Ac-(OH)Leu-Ala-Gly-NH2
CAS :Cl-Ac-(OH)Leu-Ala-Gly-NH2 is a peptide with an amino acid composition of Cl-Ac-(OH)Leu-Ala-Gly. It is synthesized by the chemical reaction of hydrochloric acid and L-alanine. This peptide has been shown to be an irreversible inhibitor of metalloendopeptidase, preventing the breakdown of proteins in the stomach. The pH profile for this peptide is acidic and its molecular weight is approximately 1296 daltons.Formule :C13H23N4O5ClDegré de pureté :Min. 95%Masse moléculaire :350.8 g/molACE antibody
ACE antibody was raised in mouse using ACE (denatured) from human kidney as the immunogen.
VPS37A antibody
VPS37A antibody was raised using a synthetic peptide corresponding to a region with amino acids SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVENDKA antibody
The NDKA antibody is a highly specific monoclonal antibody that targets alpha-fetoprotein (AFP). It has been shown to bind to AFP with high affinity and specificity, making it an ideal tool for detecting and quantifying AFP levels in various biological samples. The NDKA antibody can be used in immunoassays such as ELISA or Western blotting to study the expression and function of AFP in different physiological and pathological conditions.ML241
CAS :ML241 is a small molecule inhibitor, which is derived from a chemical synthesis process aimed at developing compounds for targeted cancer therapies. With a specific mode of action as a selective antagonist, ML241 inhibits cancer cell growth by targeting a specific signaling pathway or protein involved in cell proliferation. This targeted inhibition allows scientists to explore the molecular mechanisms within tumor environments and investigate potential therapeutic strategies that could be extended to clinical applications. ML241 is utilized primarily in preclinical studies, serving as a crucial tool in elucidating the pathways contributing to oncogenesis and evaluating the efficacy and specificity of cancer therapeutics. Researchers employ this compound to analyze cellular responses, genetic expressions, and the impact of pathway interference, thereby advancing our understanding of cancer biology and potential treatment avenues.Formule :C23H24N4ODegré de pureté :Min. 95%Masse moléculaire :372.46 g/molDL5050
CAS :DL5050 is a biodegradable, non-steroidal anti-inflammatory drug that belongs to the class of androstane receptor agonists. It has been shown to have a long-acting effect in vivo. DL5050 is not selective for any particular androgen receptor, but rather it binds to the constitutive androstane receptor, which is found in cells throughout the body. This active compound binds to the multilayer sensor with functional groups of ethylene molecules that are attached to it. The sensor then triggers a change in the ion channels located on the cell membrane surface, which leads to an increase in intracellular calcium levels. The increased calcium level activates enzymes that break down arachidonic acid (a polyunsaturated fatty acid) into prostaglandins. These enzymatic reactions lead to inflammation relief and pain reduction.Formule :C23H15Cl2N3O2Degré de pureté :Min. 95%Masse moléculaire :436.3 g/molValspodar
CAS :P-glycoprotein (MDR1) inhibitor; non-immunosuppressive cyclosporin A analog
Formule :C63H111N11O12Degré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :1,214.62 g/molGINS1 antibody
GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA
Tau antibody
The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.
RAD17 antibody
The RAD17 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. It has been shown to interact with epidermal growth factor (EGF) and TGF-beta, neutralizing their effects on cell proliferation and differentiation. This monoclonal antibody specifically targets the activated form of RAD17, inhibiting its interaction with β-catenin and other proteins involved in cell signaling pathways. The RAD17 antibody is widely used in Life Sciences research to study the function of this important cell antigen. Additionally, it has been shown to have potential therapeutic applications in diseases related to abnormal cell growth, such as cancer and adipose tissue disorders. With its high specificity and potency, the RAD17 antibody is an invaluable tool for researchers looking to gain deeper insights into cellular processes and develop innovative treatments.beta Tubulin antibody
beta Tubulin antibody was raised in mouse using recombinant human beta-Tubulin (1-445aa) purified from E. coli as the immunogen.MAGE-3 Antigen (271-279) (human) trifluoroacetate salt
CAS :ALPHA FACTOR SIGNALING PEPTIDEFormule :C53H79N13O10Degré de pureté :Min. 95%Masse moléculaire :1,058.28 g/molGANP antibody
The GANP antibody is a highly specific monoclonal antibody that is used in various assays to detect and quantify the presence of GANP (glycosylation-associated nuclear protein) in samples. It specifically recognizes the tyrosine phosphorylated form of GANP, which is activated under certain conditions. This antibody has been extensively validated and has shown high sensitivity and specificity in detecting GANP in nuclear extracts from various cell types.
Hydrocodone antibody
The Hydrocodone antibody is a monoclonal antibody that specifically targets and binds to glial fibrillary acidic protein (GFAP), an important marker for astrocytes. It has been shown to inhibit the hydroxylase activity of GFAP, which plays a key role in cholinergic neurotransmission. This antibody is widely used in Life Sciences research to study the function and regulation of astrocytes in various physiological and pathological conditions.Degré de pureté :Min. 95%4,6-Dimethyl-3-(2-methylphenyl)sulfonyl-1-propan-2-ylpyridin-2-one
CAS :4,6-Dimethyl-3-(2-methylphenyl)sulfonyl-1-propan-2-ylpyridin-2-one is a potent and selective inhibitor of protein interactions with the alpha subunit of G protein. It has been shown to be an activator of the beta subunit and a receptor for the alpha subunit. 4,6-Dimethyl-3-(2-methylphenyl)sulfonyl-1-propan-2-ylpyridin-2-one is a high quality chemical that can be used as a research tool in life science, as well as pharmacology, peptides, cell biology, and ion channels.Formule :C17H21NO3SDegré de pureté :Min. 95%Masse moléculaire :319.4 g/molLysyl-Bradykinin (Kallidin) (Human, Bovine)
CAS :Produit contrôléLysyl-bradykinin (kallidin) is a peptide that is a potent activator of non-selective cation channels. It has been shown to activate potassium channels and calcium channels, but not sodium channels. The activation by lysyl-bradykinin leads to an increase in the permeability of the membrane, which can lead to release of neurotransmitters from nerve endings. Lysyl-bradykinin also has been shown to be an inhibitor of protein interactions with the receptor in certain cell lines. The antibody used to measure this inhibition is L1420.Formule :C56H85N17O12Degré de pureté :Min. 95%Masse moléculaire :1,188.40 g/molMelanin-Concentrating Hormone (Human)
CAS :Melanin-concentrating hormone (MCH) is a neuropeptide that is used to study the regulation of food intake and body weight. MCH binds to its receptor, the melanocortin-4 receptor (MC4R), which is coupled to an ion channel. This binding causes the release of potassium ions from cells, leading to depolarization and increased neuronal excitability. It has been shown that MCH can be used as a research tool for studying ion channels, ligand-receptor interactions, and cell biology.
Formule :C105H160N30O26S4Degré de pureté :Min. 95%Masse moléculaire :2,386.8 g/molNor-6α-oxycodol
CAS :Produit contrôléNor-6α-oxycodol is a potent kinase inhibitor that has shown promising results in the treatment of tumors and cancer. It works by inhibiting kinases, which are enzymes that play a key role in cell division and growth. Nor-6α-oxycodol has been shown to induce apoptosis, or programmed cell death, in cancer cells, making it a potential anticancer drug. This compound is an analog of oxycodone, a well-known painkiller, and is excreted primarily through urine. Nor-6α-oxycodol has been studied extensively in Chinese medicinal research and has demonstrated significant activity against various types of human cancer cells. Its potential as an inhibitor for protein kinases makes it an exciting candidate for future research into novel cancer therapies.Formule :C17H21NO4Degré de pureté :Min. 95%Masse moléculaire :303.35 g/mol
![D-Arginyl-[Hyp3,Thi5,D-Tic7,Oic8]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPKB-4293-V.webp&w=3840&q=75)
