Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(100.866 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.368 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
KRT17 antibody
The KRT17 antibody is a diagnostic reagent used in Life Sciences for various applications. It is a monoclonal antibody that specifically targets Keratin 17 (KRT17), a biomolecule involved in oxidative damage and toxic effects. The KRT17 antibody exhibits high specificity and sensitivity, making it an ideal tool for research and diagnostic purposes.CDC2 antibody
The CDC2 antibody is a monoclonal antibody that is widely used in Life Sciences research. It specifically targets the CDC2 protein, which plays a crucial role in cell division and growth. By inhibiting the activity of CDC2, this antibody can help researchers study the effects of growth factors and inhibitors on cell proliferation.Degré de pureté :Min. 95%PCB 101-13C12
CAS :Produit contrôléPlease enquire for more information about PCB 101-13C12 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C12H5Cl5Degré de pureté :Min. 95%Masse moléculaire :338.3 g/molEt receptor antagonist (Pd 145065)
CAS :Et receptor antagonist (Pd 145065) is a peptide that binds to the ET receptor. It has been used as a research tool in cell biology, pharmacology and life science. Et receptor antagonist (Pd 145065) is also an inhibitor of the ET receptor that blocks ligand binding to the ET receptors. It is a high purity, water-soluble, white powder with a molecular weight of 1097.24 Da. Et receptor antagonist (Pd 145065) has CAS No. 153049-49-1 and a purity of > 98%.Formule :C52H67N7O10Degré de pureté :Min. 95%Masse moléculaire :950.1 g/mol(±)-Methionine-d4
CAS :(±)-Methionine-d4 is an activator that binds to receptors, ion channels and other proteins. This ligand has been used in research to study the effects of receptor activation and protein interactions. (±)-Methionine-d4 has been shown to be a potent inhibitor of human cytochrome P450 enzymes, which are responsible for metabolizing drugs in the body.
Formule :C5H11NO2SDegré de pureté :Min. 95%Masse moléculaire :153.24 g/molKPT-185
CAS :KPT-185 is a novel pro-apoptotic agent that selectively induces cell death in cancer cells resistant to platinum chemotherapy. KPT-185 kills tumor cells by inducing apoptosis through inhibition of the anti-apoptotic protein survivin. The drug also has minimal toxicity in mice, which may be due to its lack of effect on energy metabolism or transcriptional regulation. In addition, KPT-185 has been shown to have minimal toxicity in leukemic mice and does not cause significant changes in mouse tumor size or weight, indicating that it is well tolerated by normal tissues.Formule :C16H16F3N3O3Degré de pureté :Min. 95%Masse moléculaire :355.31 g/molFurosemide sodium
CAS :Produit contrôléFurosemide is an organic solvent that is used as a salt of furosemide sodium. It has been shown to have strong absorption in the UV range, which can be used for cellular and environmental pollution. Furosemide is also a natriuretic drug that is used to decrease blood pressure and to prevent and treat heart failure. Furosemide may be given orally or intravenously, which will lead to an increase in plasma albumin levels. This drug also binds to surfactant proteins, which are necessary for maintaining the stability of lung surfactant and preventing it from collapsing on itself. Furosemide inhibits the formation of calcium carbonate precipitates by chelating magnesium ions from solution. The drug also has a hydrodynamic effect on electrolytes such as sodium, potassium, and chloride ions. This leads to increased urinary excretion of these ions and a reduction in their concentrations in the blood plasma. Furosemide is often formulated with otherFormule :C12H10ClN2NaO5SDegré de pureté :Min. 95%Masse moléculaire :352.73 g/molL-745870 Hydrochloride
CAS :L-745870 Hydrochloride is a selective dopamine D4 receptor antagonist, which is synthesized as a research compound for neuroscientific studies. This product originates from medicinal chemistry efforts aimed at understanding the role of dopamine receptors in brain function and pathology. Its mode of action involves the competitive inhibition of the dopamine D4 receptor, a subtype of the dopamine receptor family, which plays a significant role in modulating neuronal signaling pathways associated with cognition, emotion, and potential behavioral disorders.Formule :C18H20Cl2N4Degré de pureté :Min. 95%Masse moléculaire :363.3 g/molKU 59403
CAS :KU 59403 is a potent inhibitor that functions as an anti-proliferative agent, targeting specific biochemical pathways. Developed through chemical synthesis, it primarily acts as an inhibitor of DNA-dependent protein kinase (DNA-PK). This kinase is integral to the non-homologous end joining (NHEJ) pathway, responsible for repairing double-strand breaks in DNA.Formule :C29H32N4O4S2Degré de pureté :Min. 95%Masse moléculaire :564.72 g/molPapaveroxine
CAS :Papaveroxine is a medicinal compound that has been found to have potential anticancer properties. It is an analog of elastin kinase, which plays a role in the regulation of cell growth and division. Papaveroxine has been isolated from urine samples and has shown promising results as an inhibitor of cancer cell growth and proliferation. Studies have shown that this compound induces apoptosis, or programmed cell death, in human cancer cells by inhibiting protein kinases that are involved in tumor growth. Furthermore, papaveroxine has been found to be effective against a variety of cancers, including breast, lung, and prostate cancer. This makes it a promising candidate for the development of new cancer treatments and inhibitors.Formule :C22H25NO7Degré de pureté :Min. 95%Masse moléculaire :415.4 g/molPD 168077
CAS :PD 168077 is a dopamine uptake inhibitor that is used to study the function of dopamine in the brain. It selectively inhibits the uptake of dopamine into synaptic vesicles and blocks the binding of dopamine to its receptor, leading to an increased amount of dopamine in the synapse. PD 168077 has been shown to be effective against autoimmune diseases such as multiple sclerosis, but also against cancerous cells. Studies have shown that PD 168077 inhibits protein synthesis in tumor cell cultures and inhibits tumor growth in mice.Formule :C20H22N4ODegré de pureté :Min. 95%Masse moléculaire :334.41 g/molProtac bcl2 degrader-1
CAS :Protac BCL2 Degrader-1 is a recombinant antibody that binds to human bcl2 and degrades it. It can be used as a research tool in cell biology, peptides, pharmacology, and other fields. Protac BCL2 Degrader-1 has shown to be an activator of ion channels and receptor interactions. It also has been shown to be a ligand for the following: GPCR, beta-adrenergic receptors, serotonin receptors, muscarinic receptors, nicotinic acetylcholine receptors. Protac BCL2 Degrader-1 is also known as CAS No. 2378801-85-3.Formule :C45H45BrN6O10SDegré de pureté :Min. 95%Masse moléculaire :941.8 g/molHBsAg ayw
HBsAg is the surface antigen of the Hepatitis-B-Virus (HBV). The capsid of a virus has different surface proteins from the rest of the virus. The antigen is a protein that binds specifically on one of these surface proteins. It is commonly referred to as the Australian Antigen.Recombinant HbsAg ayw full length is a 24kDa protein cloned from HBV 320 genome.Degré de pureté :>99% By Sds-PageMubritinib
CAS :Irreversible inhibitor of HER2 tyrosine kinaseFormule :C25H23F3N4O2Degré de pureté :Min. 95%Masse moléculaire :468.47 g/molPf-956980 hydrate
CAS :Pf-956980 hydrate is a pyrrolopyrimidine compound that is a potential inhibitor of protein-tyrosine kinase. Pf-956980 hydrate binds to the ATP binding site and inhibits the enzyme activity. Pf-956980 hydrate has been shown to inhibit the enzymatic activity of protein tyrosine kinase in vitro. This compound was also shown to bind to ATP, which suggests that it may be an effective inhibitor of this enzyme.Formule :C18H26N6O·H2ODegré de pureté :Min. 95%Masse moléculaire :342.44 g/molJG98
CAS :JG98 is a model system for the study of protein synthesis and chaperone function. This system uses human proteins that are modified with a chemical inhibitor to mimic the physiological effects of mutations in these proteins. JG98 provides a cell culture-based method that is membrane permeable and allows for the study of protein synthesis, chaperone function, and other cellular processes in vitro. The JG98 system has been used to investigate the role of chaperones in protein synthesis, as well as to identify chemical inhibitors that affect protein synthesis and cellular processes.Formule :C24H21Cl2N3OS3Degré de pureté :Min. 95%Masse moléculaire :534.54 g/molTCS OX2 29
CAS :TCS OX2 29 is a vasoactive intestinal peptide (VIP) receptor agonist that has been shown to have analgesic effects in rats. TCS OX2 29 is an excitatory neurotransmitter, which may be due to its ability to stimulate the release of glutamate and increase the activity of postsynaptic receptors. TCS OX2 29 also has a significant interaction with antinociceptive drugs such as morphine, which may be due to its ability to activate opioid receptors. Patch-clamp experiments on tegmental neurons have shown that TCS OX2 29 increases the frequency of spontaneous action potentials in these cells. It also induces locomotor activity in mice and pain hypersensitivity in rats. TCS OX2 29 has been used as an experimental model for symptoms associated with Parkinson’s disease, such as akinesia and muscle rigidity.
Formule :C23H31N3O3·HClDegré de pureté :Min. 95%Masse moléculaire :433.97 g/molNVP HDM 201
CAS :Inhibitor of Mdm2-p53 interactionFormule :C26H24Cl2N6O4Degré de pureté :Min. 95%Masse moléculaire :555.41 g/mol(Z)-2-((4-(Phenethylamino)-1-styryl-1H-pyrazolo[3,4-d]pyrimidin-6-yl)amino)ethan-1-ol
CAS :(Z)-2-((4-(Phenethylamino)-1-styryl-1H-pyrazolo[3,4-d]pyrimidin-6-yl)amino)ethan-1-ol is a research tool that is used in cell biology and pharmacology. It is an activator that binds to the receptor and activates it by either increasing or decreasing the activity of ion channels. It also binds to antibodies and inhibits protein interactions. This ligand has been shown to inhibit the activity of ion channels such as potassium channels, calcium channels, sodium channels, and chloride channels.Formule :C23H24N6ODegré de pureté :Min. 95%Masse moléculaire :400.5 g/molETP-46321
CAS :ETP-46321 is an imidazopyrazine that inhibits the activity of the enzyme phosphatase 2A, which is involved in a number of signaling pathways. It has been shown to activate IL-17a, and inhibit tumor growth in mice. ETP-46321 also has pharmacokinetic properties that are suited for oral administration. The drug binds to the catalytic subunit of protein phosphatase 2A (PP2Ac) and prevents it from dephosphorylating its substrate, thereby inhibiting its enzymatic activity. This inhibition leads to increased levels of activated PP2Ac, which in turn leads to the activation and proliferation of cells. ETP-46321 has shown efficacy against cancer cells in vitro and can be used as an immunosuppressant for autoimmune diseases due to its ability to inhibit IL-17a production by T cells.Formule :C20H27N9O3SDegré de pureté :Min. 95%Masse moléculaire :473.55 g/molMK 386
CAS :MK 386 is a thiazolidinedione that has been shown to decrease insulin resistance and improve insulin sensitivity. It also decreases the production of sulfurous compounds in the body, which have been shown to be responsible for hair loss. MK 386 is a sulfate prodrug that is converted to its active form by sulfotransferases, enzymes found in many tissues. MK 386 has been shown to normalize follicle size and increase hair growth in patients with alopecia. The uptake of MK 386 is oriented towards the insulin-sensitive tissue such as muscle cells, adipocytes, and liver cells, while finasteride blocks the receptor that responds to testosterone.Formule :C28H49NODegré de pureté :Min. 95%Masse moléculaire :415.7 g/molHydromethylthionine
CAS :Hydromethylthionine is a redox buffer that is used in wastewater treatment. It is also used as a model system for biological treatment, where it can be used to study the transport properties of amyloid protein. Hydromethylthionine has been shown to have transport properties that are similar to those of methylene and linear calibration curves. Hydromethylthionine has good chemical stability and does not decompose readily in tissue culture or rat liver microsomes.Formule :C16H19N3SDegré de pureté :Min. 95%Masse moléculaire :285.4 g/molAtp synthase inhibitor 1
CAS :ATP Synthase Inhibitor 1 is a chemical compound used in biochemical research, which is sourced synthetically to target ATP synthase, an essential enzyme in cellular energy production. The compound functions by binding to ATP synthase, thereby disrupting its catalytic activity, and effectively halting the conversion of ADP to ATP. This inhibition acts as a powerful tool for investigating cellular metabolism, bioenergetics, and the role of ATP synthase in pathological conditions such as cancer and neurodegenerative diseases. Researchers utilize it to simulate conditions of cellular energy deprivation or to study the cellular response to impaired ATP production, providing significant insights into mitochondrial function and cellular energy dynamics.Formule :C17H18ClN3O3S2Degré de pureté :Min. 95%Masse moléculaire :411.9 g/molBIRT 377
CAS :BIRT 377 is a humanized monoclonal antibody with specificity for the inflammatory molecule MCP-1. It is being developed as a therapy for inflammatory bowel disease, which is characterized by chronic inflammation of the gastrointestinal tract. BIRT 377 binds to MCP-1 and blocks its interaction with the receptor CCR2 on the surface of cells in the gastrointestinal tract. This prevents inflammatory responses that are responsible for tissue damage and ulceration. BIRT 377 has been shown to be effective in animal models of inflammatory bowel disease, and clinical studies are underway in humans.
Formule :C18H15BrCl2N2O2Degré de pureté :Min. 95%Masse moléculaire :442.1 g/molTianeptine
CAS :Produit contrôléTianeptine is a selective serotonin reuptake inhibitor that is used to treat depression. It has been demonstrated to have antidepressant effects in animals, and has been shown to increase the extracellular levels of glutamate in the hippocampus. Tianeptine may be effective in treating diseases such as infectious disease, bowel disease, and toll-like receptor (TLR) activation. The mechanism of action for tianeptine is not fully understood; however, it is believed that it acts by inhibiting glutamate uptake into presynaptic neurons and increasing serotonin levels in the brain. This drug also has an effect on receptors, which may be due to its ability to inhibit the binding of certain drugs to their receptors or block the activity of certain receptors.Formule :C21H25ClN2O4SDegré de pureté :Min. 95%Masse moléculaire :436.96 g/molMDV 3100-d3
CAS :MDV 3100-d3 is a research tool and activator of the Ligand Receptor Complex. It is used in Cell Biology to study protein interactions and the pharmacology of peptides, as well as in molecular biology and biochemistry. MDV 3100-d3 binds to ion channels and can be used to inhibit their function. This inhibitor has been shown to have high purity, which makes it a valuable research tool for studying protein interactions and the pharmacology of peptides.Formule :C21H13D3F4N4O2SDegré de pureté :Min. 95%Masse moléculaire :467.5 g/molJNJ0966
CAS :JNJ0966 is a zymogen that has been shown to be activated after cleavage by trypsin and enterokinase. It inhibits the activity of epidermal growth factor (EGF) and its receptor, EGFR, as well as other growth factors. JNJ0966 blocks the kinase signaling pathways in cells and prevents the phosphorylation of tyrosine residues on proteins that are involved in cell proliferation, survival, and differentiation. JNJ0966 has been shown to inhibit tumor growth in vitro and in vivo. This drug also possesses anti-inflammatory properties, which may stem from inhibition of cytokines such as IL-2 or TNF-α.
Formule :C16H16N4O2S2Degré de pureté :Min. 95%Masse moléculaire :360.45 g/molHIV1 p24 antibody
HIV1 p24 antibody was raised in mouse using HIV1 p24 (native antigen) as the immunogen.ZBTB33 antibody
ZBTB33 antibody was raised in rabbit using the N terminal of ZBTB33 as the immunogenDegré de pureté :Min. 95%Ighmbp2 antibody
Ighmbp2 antibody was raised in rabbit using the N terminal of Ighmbp2 as the immunogenDegré de pureté :Min. 95%RANK antibody
The RANK antibody is a monoclonal antibody that specifically targets the receptor activator of nuclear factor kappa-B (RANK). It has been extensively studied for its role in regulating bone remodeling and immune cell activation. The RANK antibody binds to RANK, preventing its interaction with its ligand, RANKL. This inhibits the activation of osteoclasts, which are responsible for bone resorption, and reduces the production of pro-inflammatory cytokines by immune cells. Additionally, the RANK antibody has been shown to have therapeutic potential in treating conditions such as osteoporosis, rheumatoid arthritis, and certain types of cancer. Its high specificity and affinity make it a valuable tool for researchers in the life sciences field.STAT3 antibody
STAT3 antibody was raised in Mouse using a purified recombinant fragment of human STAT3 expressed in E. coli as the immunogen.ZNF502 antibody
ZNF502 antibody was raised in rabbit using the N terminal of ZNF502 as the immunogenDegré de pureté :Min. 95%MYC antibody
The MYC antibody is a monoclonal antibody that specifically targets the c-myc protein. This protein plays a crucial role in cell growth and proliferation, as well as in the regulation of genes involved in various cellular processes. The MYC antibody acts as an inhibitory factor, preventing the binding of c-myc to its target genes and thereby suppressing their expression.Turkey RBC antibody
Turkey RBC antibody was raised in rabbit using meleagris erythrocytes as the immunogen.
Degré de pureté :Min. 95%AKAP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP7 antibody, catalog no. 70R-2689Degré de pureté :Min. 95%CTNNB1 antibody
The CTNNB1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and is produced using a lyophilization method for enhanced stability and longevity. This Monoclonal Antibody targets the CTNNB1 protein, also known as beta-catenin, which plays a crucial role in cell adhesion and signaling pathways.Syntelin
CAS :Syntelin is a peptide inhibitor that binds to the Thr-Gly-Asp (TGG) motif of proteins. It inhibits protein interactions and has been shown to be an activator for some receptors. Syntelin is a high purity, research tool that can be used in the study of ion channels and antibody production. Syntelin is a synthetic peptide with CAS No. 438481-33-5.
Formule :C21H20N6O2S3Degré de pureté :Min. 95%Masse moléculaire :484.6 g/molTrx antibody
The Trx antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the growth hormone receptor, allowing for accurate detection and analysis of this important protein. The Trx antibody has been extensively tested and validated for its effectiveness in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). With its high affinity and specificity, the Trx antibody provides reliable and reproducible results in detecting growth hormone receptor expression in human serum samples. Additionally, this antibody has been shown to be effective in identifying autoantibodies and chemokines involved in interferon signaling pathways. Its unique characteristics make the Trx antibody an essential tool for researchers investigating the role of growth hormone receptor activation in various biological processes.
CHRNA3 antibody
CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNDegré de pureté :Min. 95%LSM14A antibody
LSM14A antibody was raised using a synthetic peptide corresponding to a region with amino acids TSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPLSS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LSS antibody, catalog no. 70R-2748Degré de pureté :Min. 95%Mouse anti Human IgE (HRP)
Mouse anti human IgE (HRP) was raised in mouse using human IgE as the immunogen.NKAIN4 antibody
NKAIN4 antibody was raised using the middle region of NKAIN4 corresponding to a region with amino acids LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLPDegré de pureté :Min. 95%POLR2B antibody
POLR2B antibody was raised in rabbit using the middle region of POLR2B as the immunogenDegré de pureté :Min. 95%Decr2 antibody
Decr2 antibody was raised in rabbit using the C terminal of Decr2 as the immunogenDegré de pureté :Min. 95%CD25 antibody
The CD25 antibody is a cytotoxic monoclonal antibody that specifically targets activated T cells expressing the CD25 antigen. It is commonly used in immunoassays and research in the field of Life Sciences. This antibody can be conjugated to colloidal gold or other markers for detection purposes. The CD25 antibody has been shown to neutralize the activity of interleukin-17A (IL-17A), a cytokine involved in inflammation and autoimmune diseases. It works by binding to the IL-17A receptor on target cells, preventing IL-17A from exerting its effects. The CD25 antibody can also be used as a therapeutic drug for conditions where excessive activation of T cells is undesirable. Its phosphatase activity allows it to modulate T cell signaling pathways, leading to suppression of immune responses. With its high specificity and affinity, this monoclonal antibody offers great potential for targeted therapies and diagnostic applications in various fields of research.MTHFS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFS antibody, catalog no. 70R-4127Degré de pureté :Min. 95%Cpa3 antibody
Cpa3 antibody was raised in rabbit using the N terminal of Cpa3 as the immunogenDegré de pureté :Min. 95%RHBG antibody
RHBG antibody was raised using a synthetic peptide corresponding to a region with amino acids RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQRDegré de pureté :Min. 95%IDH2 antibody
IDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKNR3C1 antibody
NR3C1 antibody was raised in rabbit using the N terminal of NR3C1 as the immunogenDegré de pureté :Min. 95%SNX4 antibody
The SNX4 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It is designed to target and bind to the SNX4 protein, which plays a crucial role in various cellular processes such as collagen synthesis and lysis. This antibody is widely used in immunoassays and research studies within the Life Sciences field.WWP2 antibody
WWP2 antibody was raised using the C terminal of WWP2 corresponding to a region with amino acids IDKVGKETWLPRSHTCFNRLDLPPYKSYEQLREKLLYAIEETEGFGQERAB3A antibody
The RAB3A antibody is a polyclonal antibody that is cytotoxic and reactive. It can be used in various applications in the field of Life Sciences. This antibody specifically targets RAB3A, a protein involved in vesicle trafficking and neurotransmitter release. By binding to RAB3A, the antibody can modulate its function and potentially inhibit cellular processes that rely on this protein. Additionally, the RAB3A antibody has been shown to have antiviral properties and can be used as a tool to study viral infections. It is highly immunogenic and can elicit a strong antigen-antibody reaction. Researchers can use this antibody to detect the presence of RAB3A in samples and further investigate its role in cellular processes. With its versatility and wide range of applications, the RAB3A antibody is an essential tool for scientists studying protein-protein interactions, cellular signaling pathways, and immune responses.ABHD13 antibody
ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGNDegré de pureté :Min. 95%BSG antibody
BSG antibody is an inhibitor that targets the microparticles found in activated cells. It plays a crucial role in reducing microvessel density and inhibiting protein kinase activity. This antibody is known for its ability to neutralize autoantibodies, making it an effective agent for treating various diseases. BSG antibody also has the unique ability to interact with low-density lipoprotein receptors, aiding in the regulation of lipid metabolism. In the field of Life Sciences, this monoclonal antibody has shown promising results in studying bilayer membrane dynamics and protease activity. Moreover, BSG antibody has been found to be effective against atypical hemolytic disorders and can inhibit the growth factor signaling pathway. With its versatility and wide range of applications, BSG antibody is a valuable tool for researchers and clinicians alike.CDK6 antibody
The CDK6 antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the structure and function of actin filaments in cells. This monoclonal antibody recognizes GFAP, a glycoprotein found in astrocytes and other glial cells. The CDK6 antibody can be used for various applications such as immunohistochemistry, immunofluorescence, and western blotting. It provides highly specific and sensitive detection of GFAP, allowing researchers to investigate the role of this protein in various cellular processes. With its high affinity and excellent performance, the CDK6 antibody is an essential tool for scientists studying glial cell biology and related fields.
MRP9 antibody
MRP9 antibody is a protein used in the field of Life Sciences and medicine. It is an antibody that specifically targets and inhibits the activity of MRP9, which is a biomarker associated with cellular immunotherapy. The antibody works by binding to MRP9 and preventing its function, thereby inhibiting the emission of interferon and other signaling molecules involved in immune responses. This inhibitor has been extensively studied and validated using various techniques such as cdna microarray analysis and reductase assays. MRP9 antibody can be used as a diagnostic biomarker to assess the presence or activity of MRP9 in cells or tissues, providing valuable information for disease diagnosis and treatment. Additionally, this antibody has shown promising results in caveolin-1-mediated cellular processes, making it a potential candidate for targeted therapies in various diseases.Copine I Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPNE1 antibody, catalog no. 70R-1407Degré de pureté :Min. 95%TRIM54 antibody
TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA
ZNF766 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF766 antibody, catalog no. 70R-8882Degré de pureté :Min. 95%GRIA1 antibody
The GRIA1 antibody is a therapeutically valuable reagent that specifically targets the DNA double-strand of the GRIA1 gene. It is an extracellular antibody that can be used to test the efficacy of various compounds in inhibiting the activity of GRIA1. This antibody is particularly useful in pluripotent stem cell research, as it can help identify and isolate cells with high affinity for specific ligands. Additionally, the GRIA1 antibody can be utilized in immunohistochemical studies to visualize and analyze the expression of GRIA1 protein in different tissues and cell types. With its applications in Life Sciences and Monoclonal Antibodies, this antibody plays a crucial role in unraveling the interstitial functions of GRIA1 and advancing our understanding of pluripotent stem cells.ARF6 antibody
The ARF6 antibody is a cation that belongs to the group of polyclonal antibodies. It is derived from human serum albumin and is commonly used in life sciences research. This antibody specifically targets the epidermal growth factor (EGF) and has neutralizing properties against this growth factor. The ARF6 antibody can be used in various immunoassays to detect and quantify EGF-like molecules, such as chemokines, in biological samples. Its high affinity for human serum albumin ensures optimal binding and detection sensitivity. Researchers rely on the ARF6 antibody to accurately measure the levels of EGF and related molecules in their experiments.Glutamate Dehydrogenase protein (Bovine)
Glutamate Dehydrogenase (GDH, L-GDH, GDH1, NAD(P)+ GDH1, mitochondrial Glutamate dehydrogenase 1, systemic name L-Glutamate:NAD(P)+ oxidoreductase, Cas No [9029-12-3], EC 1.4.1.4) is an enzyme that catalyzes the following reaction: L-glutamate + H2O + NADP+ ⇌ α-ketoglutarate + NH4+ + NADPH One unit of Glutamate Dehydrogenase will catalyze the oxidation of 1.0 μmol of NADH and the reductive amination of one micromole of alpha-ketoglutarate per minute at pH 7.95 and 37°C in the presence of ADP. Bovine liver Glutamate Dehydrogenase is supplied in lyophilized form as a tan powder. It was lyophilized from sodium citrate and mannitol buffer, the activity is ≥15U/mg solid, specific activity ≥20U/mg protein. Store at -20°C on arrival.NADP+ is available here and NADPH is available here, depending on whether you require the reaction to proceed from left to right or from right to left, respectively.Degré de pureté :Min. 95%Slc12a5 antibody
Slc12a5 antibody was raised in rabbit using the N terminal of Slc12a5 as the immunogenDegré de pureté :Min. 95%MMP1 antibody
The MMP1 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets the matrix metalloproteinase 1 (MMP1), an enzyme involved in the breakdown of collagen. This antibody can be used to detect and quantify MMP1 levels in various samples, such as tissue lysates or cell culture supernatants.Dopamine D3 Receptor antibody
Dopamine D3 receptor antibody was raised in rabbit using a 19 amino acid peptide of human D3R as the immunogen.Degré de pureté :Min. 95%GPR68 antibody
GPR68 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%
![(Z)-2-((4-(Phenethylamino)-1-styryl-1H-pyrazolo[3,4-d]pyrimidin-6-yl)amino)ethan-1-ol](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FSFC81646.webp&w=3840&q=75)
