Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(100.866 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.368 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Furazolidone monoclonal antibody
The Furazolidone monoclonal antibody is a highly specialized and targeted therapeutic agent used in the field of Life Sciences. This monoclonal antibody specifically targets extracellular substances found in blood plasma, making it a valuable tool in various medical applications. It has shown promising results in the treatment of leukemia and other related conditions.
EPHB3 antibody
EPHB3 antibody is a glycoprotein that belongs to the family of binding proteins. It is a polyclonal antibody that can specifically target and bind to EPHB3, a receptor protein involved in various cellular processes. This antibody has been shown to have neutralizing properties against interferon and autoantibodies. Additionally, EPHB3 antibody can inhibit the activity of chemokines and multidrug resistance proteins, making it a valuable tool in life sciences research. It has also demonstrated reactivity against antiviral agents and extracellular histones. Furthermore, this antibody has shown potential as an anticancer agent, with studies indicating its effectiveness in suppressing cell growth and inducing apoptosis in HL-60 cells.ITGAV antibody
The ITGAV antibody is a monoclonal antibody that belongs to the class of human immunoglobulins. It specifically targets and binds to the ITGAV protein, which is involved in various cellular processes such as cell adhesion, migration, and signaling. This antibody has been shown to have neutralizing effects on chemokines, steroids, growth hormone receptors, and interferons.Human Growth Hormone antibody
The Human Growth Hormone antibody is a reactive monoclonal antibody that specifically targets and neutralizes the human serum albumin protein. This antibody has been extensively studied in the field of Life Sciences and has shown potential therapeutic applications. It can be used to inhibit the activity of growth hormone or other agonist proteins, making it an important tool for research and development.RDH16 antibody
RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVDegré de pureté :Min. 95%AMA1 protein
AMA1 protein is a key component in the field of Life Sciences. It is involved in various processes, including adipose activation and creatine kinase activity. This protein can be found in human serum and plays a crucial role in the apical membrane function. The AMA1 protein can be immobilized using an electrode and has been studied in relation to sorafenib treatment. Recombinant forms of this protein, along with specific monoclonal antibodies, are widely used in research and diagnostic applications. Additionally, AMA1 protein has been found to interact with collagen, further highlighting its importance in cellular processes.Degré de pureté :Min. 95%ATXN2 antibody
ATXN2 antibody was raised in rabbit using the middle region of ATXN2 as the immunogenDegré de pureté :Min. 95%NMT2 antibody
The NMT2 antibody is a highly specialized biological agent that has a range of important applications in the field of Life Sciences. This antibody is known for its high bioavailability and exceptional binding affinity to erythropoietin receptors. It has been extensively studied for its ability to modulate various biological effects, including angiogenic response and the production of polyunsaturated fatty acids such as arachidonic acid.
MTCH1 antibody
MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFADegré de pureté :Min. 95%CD70 antibody
The CD70 antibody is a monoclonal antibody that targets the CD70 protein. It has been shown to inhibit the activity of phosphatase and nuclear factor kappa-light-chain-enhancer in B cells, leading to decreased polymerase activity and growth factor activation. This antibody also has cytotoxic effects on mycoplasma genitalium, as it activates endonuclease and caspase-9, resulting in cell death. The CD70 antibody is widely used in Life Sciences research and has potential applications in the development of targeted therapies for various diseases.LRRTM4 antibody
LRRTM4 antibody was raised using the middle region of LRRTM4 corresponding to a region with amino acids FYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQVVNTERSHDegré de pureté :Min. 95%OSGIN1 antibody
OSGIN1 antibody was raised using the N terminal of OSGIN1 corresponding to a region with amino acids APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWDegré de pureté :Min. 95%NEK6 antibody
The NEK6 antibody is a highly specialized monoclonal antibody that is used in various applications within the Life Sciences field. It is designed to target and bind to NEK6, an enzyme involved in cell cycle regulation and signaling pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.
RAB5B antibody
RAB5B antibody was raised using the N terminal of RAB5B corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQEDegré de pureté :Min. 95%RDH11 antibody
RDH11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARDegré de pureté :Min. 95%Esrrg antibody
Esrrg antibody was raised in rabbit using the middle region of Esrrg as the immunogenDegré de pureté :Min. 95%Rat Lymphocyte antibody
Rat lymphocyte antibody was raised in rabbit using RBC-free rat thymus and spleen cells as the immunogen.Degré de pureté :Min. 95%EPHA5 antibody
The EPHA5 antibody is a highly specialized antibody that targets the epidermal growth factor. It plays a crucial role in various Life Sciences applications, particularly in the study of adipose tissues. This antibody has been shown to affect important cellular processes such as glycosylation and cell adhesion through its interaction with proteins like E-cadherin and β-catenin.BPGM antibody
BPGM antibody was raised using the middle region of BPGM corresponding to a region with amino acids EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKCarbonic Anhydrase VIII antibody
Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQHMGCS1 protein
HMGCS1 protein is a key enzyme involved in the biosynthesis of cholesterol. It plays a crucial role in regulating cholesterol levels in the body. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various research studies.
Degré de pureté :Min. 95%RAB1A antibody
The RAB1A antibody is a highly specific antibody that targets the RAB1A protein. RAB1A is a small GTPase that plays a crucial role in intracellular vesicular transport. It is involved in the regulation of membrane trafficking, including the transport of proteins from the endoplasmic reticulum to the Golgi apparatus.TLK1 antibody
TLK1 antibody was raised using the N terminal of TLK1 corresponding to a region with amino acids ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGDegré de pureté :Min. 95%BTN1A1 antibody
BTN1A1 antibody is a monoclonal antibody that specifically targets BTN1A1, a nuclear protein involved in cell growth and differentiation. This antibody has been shown to inhibit the activity of BTN1A1 and can be used as an inhibitor in various research applications. It is particularly effective against HER2-positive breast cancer cells, making it a promising candidate for targeted therapy with trastuzumab. The BTN1A1 antibody recognizes the amino group and carbonyl group of BTN1A1, allowing for precise binding and inhibition of its function. In addition, this antibody has been used in studies related to alpha-synuclein aggregation and nucleotide molecule interactions. With its high specificity and low density, the BTN1A1 antibody is a valuable tool for life sciences research.MCM3 antibody
MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE
Degré de pureté :Min. 95%Amylin antibody
Amylin antibody was raised in rabbit using amylin as the immunogen.Degré de pureté :Min. 95%HSPBP1 antibody
The HSPBP1 antibody is a monoclonal antibody that has been extensively studied in the field of Life Sciences. It has shown great potential in various applications such as molecular docking, immunoassays, and enzyme substrates. This antibody specifically targets HSPBP1, a protein involved in fibrinogen metabolism and microvascular endothelium function.GPR37 antibody
GPR37 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%GPI antibody
The GPI antibody is a monoclonal antibody that specifically targets the CD3 receptor, which is expressed on T cells. This antibody has been extensively studied and shown to have various applications in the field of Life Sciences. It has been used in research to investigate the role of CD3 receptor in immune responses and signaling pathways.GABA-BSA
GABA-BSA is a monoclonal antibody that is used in various applications in the field of Life Sciences. It is commonly used for hybridization studies, where it helps in identifying specific targets and detecting their presence. GABA-BSA can also be used in biochemical assays to study the interaction between proteins and other molecules. Additionally, this monoclonal antibody has been found to have antiviral properties by neutralizing certain viruses. Furthermore, GABA-BSA has shown potential as an activator of lipoprotein lipase, an enzyme involved in lipid metabolism. Its ability to inhibit lipid peroxidation makes it a valuable tool in research related to oxidative stress. With its versatility and effectiveness, GABA-BSA is a valuable asset for scientists and researchers in the field of Life Sciences.FAK antibody
FAK antibody is a monoclonal antibody that targets focal adhesion kinase (FAK), a protein involved in cell adhesion and migration. This antibody has been shown to bind specifically to FAK and inhibit its activity. It has also been used in research studies to detect FAK expression in various tissues, including amyloid plaques in Alzheimer's disease. Additionally, FAK antibodies have been used to study the interaction between FAK and other proteins, such as chimeric proteins or tyrosine or peptidyl-prolyl antibodies. In the field of Life Sciences, polyclonal antibodies raised against FAK are commonly used for Western blotting or immunohistochemistry experiments. These antibodies have also been employed in studies investigating the role of FAK in signaling pathways related to brain natriuretic peptide or tissue transglutaminase. Furthermore, FAK antibodies can be utilized in diagnostic assays for detecting FAK antigen levels in human serum samples using techniques like electrode activation.ABL1 antibody
The ABL1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target adipose lipase. This monoclonal antibody plays a crucial role in regulating triglyceride lipase activity, which is essential for maintaining lipid homeostasis. Additionally, it has been shown to interact with various growth factors, including endothelial growth factor and hepatocyte growth factor receptor.GMF gamma antibody
GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY
Degré de pureté :Min. 95%KIF15 antibody
KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQLDegré de pureté :Min. 95%PDIK1L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDIK1L antibody, catalog no. 70R-4178Degré de pureté :Min. 95%MYBPC2 antibody
MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTDegré de pureté :Min. 95%L1CAM antibody
The L1CAM antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets L1 cell adhesion molecule (L1CAM), which plays a crucial role in cell-to-cell interactions and neural development. This antibody has been extensively studied and validated for various applications, including immunohistochemistry and Western blotting.TIGD1 antibody
TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTESCF antibody
The SCF antibody is a monoclonal antibody that specifically targets the stem cell factor (SCF). It is widely used in life sciences research, particularly in the field of adipocyte biology. SCF plays a crucial role in the development and function of adipose tissue, making it an important target for therapeutic interventions related to obesity and metabolic disorders.Degré de pureté :Min. 95%CSHL1 antibody
CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVDegré de pureté :Min. 95%RNF20 antibody
The RNF20 antibody is a highly specialized antibody used in Life Sciences research. It is available in both polyclonal and monoclonal forms. This antibody specifically targets mucin, a glycoconjugate that plays a crucial role in cell growth and development. The RNF20 antibody can be used for various applications, including lysis of cells, neutralizing specific proteins or growth factors, and detecting the presence of mucin in samples. It is a valuable tool for researchers studying cellular processes and exploring potential therapeutic targets. Whether you need a polyclonal or monoclonal antibody, the RNF20 antibody offers high specificity and potency to support your scientific investigations.Rat IgM antibody
The Rat IgM antibody is a highly versatile and effective tool used in various research applications in the field of Life Sciences. This antibody belongs to the category of Isotype Controls and is widely used as a control for experiments involving monoclonal antibodies. It specifically targets molecules such as trastuzumab, tyrosine, cortisol, and low-density lipoprotein (LDL).
Degré de pureté :Min. 95%NMT2 antibody
The NMT2 antibody is a highly specific monoclonal antibody that is derived from a hybridoma cell line. It targets the chemokine NMT2, a glycoprotein that is activated in certain disease conditions. This antibody has been extensively studied and has shown great potential as a therapeutic agent in various medical applications.UCHL1 protein
The UCHL1 protein is a multifunctional protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising applications in different areas.Degré de pureté :Min. 95%COX10 antibody
COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGDegré de pureté :Min. 95%FOLH1 antibody
FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVADegré de pureté :Min. 95%TBK1 antibody
TBK1 antibody was raised using the middle region of TBK1 corresponding to a region with amino acids QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQDegré de pureté :Min. 95%AHR antibody
AHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%KCNA5 antibody
KCNA5 antibody was raised in rabbit using the N terminal of KCNA5 as the immunogenDegré de pureté :Min. 95%SOCS3 antibody
The SOCS3 antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and specifically targets autoantibodies. The antibody works by inhibiting the glycosylation process and blocking the activity of the phosphatase enzyme. Additionally, it has been shown to effectively neutralize the action of various growth factors.TAPBP antibody
TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRDegré de pureté :Min. 95%
