Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(100.866 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.368 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
ANXA1 antibody
The ANXA1 antibody is a life sciences product that belongs to the category of extracellular antibodies. It is a medicament substance that interacts with calcium ions and targets annexin A1, a protein involved in various cellular processes. This antibody can be used for research purposes, such as isolating nucleic acids or studying the function of carbohydrates and peptides. The ANXA1 antibody specifically recognizes and binds to annexin A1, allowing for the detection and analysis of this protein in biological samples. With its high specificity and affinity, this monoclonal antibody provides researchers with a valuable tool for studying the role of annexin A1 in different biological systems. Its amino acid sequence has been carefully designed to ensure optimal binding and performance in various experimental settings. Whether you're investigating signaling pathways or exploring new therapeutic targets, the ANXA1 antibody offers reliable results and contributes to advancing scientific knowledge in the field of life sciences.ACTA2 antibody
The ACTA2 antibody is a highly specialized monoclonal antibody that targets actin filaments in human serum. It has been extensively tested and proven to be cytotoxic against a wide range of cells. This antibody works by binding to actin filaments, disrupting their structure and function, ultimately leading to cell death.
Hamster RBC antibody
Hamster RBC antibody was raised in rabbit using hamster erythrocytes as the immunogen.Degré de pureté :Min. 95%ETV3L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ETV3L antibody, catalog no. 70R-8690Degré de pureté :Min. 95%SYNGR4 antibody
The SYNGR4 antibody is a highly advanced nanocomposite medicament that has shown remarkable efficacy in various applications within the field of Life Sciences. This monoclonal antibody, which has been pegylated for enhanced stability and bioavailability, exhibits exceptional binding affinity towards collagen in human serum. Through its unique mechanism of action, the SYNGR4 antibody effectively targets and neutralizes specific markers, such as alpha-fetoprotein, adeno-associated antibodies, and actin antibodies.PAPPA antibody
The PAPPA antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the protein known as pregnancy-associated plasma protein A (PAPPA). This antibody is produced using advanced techniques and is carefully formulated to ensure optimal performance.GAPDH antibody
GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC3-Hydroxy ivabradine
CAS :Please enquire for more information about 3-Hydroxy ivabradine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C26H34N2O5Degré de pureté :Min. 95%Masse moléculaire :454.6 g/molGMCSF antibody
The GMCSF antibody is a neutralizing antibody that acts as an inhibitor in the field of Life Sciences. It targets and binds to tyrosine residues, preventing the activation of certain cellular pathways. This antibody can be used in various applications such as immunohistochemistry, where it helps visualize specific proteins or cells of interest. Additionally, the GMCSF antibody has been shown to have therapeutic potential in conditions like endotoxemia, where it can neutralize the effects of inflammatory cytokines like TNF-α. It has also been studied for its role in modulating actin dynamics and regulating cellular responses to stimuli. The GMCSF antibody is commonly used in research settings and is available as a purified form for easy use.CDC2 antibody
CDC2 antibody was raised using the middle region of Cdc2 corresponding to a region with amino acids DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP
Degré de pureté :Min. 95%FBXW7 antibody
FBXW7 antibody was raised using the C terminal of FBXW7 corresponding to a region with amino acids LKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDegré de pureté :Min. 95%MKNK2 antibody
MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQLDegré de pureté :Min. 95%MLF2 antibody
MLF2 antibody was raised using the middle region of MLF2 corresponding to a region with amino acids DSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAFFZD4 antibody
The FZD4 antibody is a highly active agent that functions as a steroid receptor. It has been extensively studied and proven to effectively modulate cortisol concentration in various experimental settings. This antibody has shown promising results in inhibiting the growth of MCF-7 cells, particularly when used in combination with trastuzumab and epidermal growth factor. Additionally, it has demonstrated its efficacy in targeting low-density lipoprotein receptors, making it a valuable tool in Life Sciences research. The FZD4 antibody also plays a crucial role in the detection and analysis of autoantibodies and serves as an essential component for the development of inhibitors and monoclonal antibodies. With its exceptional specificity and reliability, this antibody offers immense potential for advancing scientific discoveries in the field of cortisol regulation and related areas.ACTR3B antibody
ACTR3B antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR
TBK1 antibody
TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM
Degré de pureté :Min. 95%TANK antibody
The TANK antibody is a polyclonal antibody used in Life Sciences research. It specifically targets TGF-beta, epidermal growth factor, and other proteins present in human serum. This antibody has cytotoxic properties and can neutralize the effects of alpha-fetoprotein, chemokines, and growth factors. The TANK antibody can be used in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. Its high affinity for its target proteins ensures accurate and reliable results in experiments. Researchers can rely on the TANK antibody to study the role of these proteins in different biological processes and diseases.Degré de pureté :Min. 95%Thrombin Receptor antibody
The Thrombin Receptor antibody is a powerful tool for researchers in the field of Life Sciences. This antibody, available in both polyclonal and monoclonal forms, targets the thrombin receptor, which plays a crucial role in various biological processes. By binding to the receptor, this antibody can act as a receptor antagonist, blocking its signaling pathways and providing valuable insights into its function.Thiamphenicol antibody
Thiamphenicol antibody is a polyclonal antibody that acts as an inhibitor against the hormone peptide MCF-7. This antibody is widely used in Life Sciences research and has shown effectiveness in targeting antigens such as anti-CD20. It can be immobilized on electrodes for various applications, including the detection and quantification of chemokines. Additionally, this antibody can be used in the development of monoclonal antibodies and antibody-drug conjugates. Its potential therapeutic applications include targeting amyloid plaques in neurodegenerative diseases.Degré de pureté :Min. 95%TMEM166 antibody
TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLADegré de pureté :Min. 95%PPAR antibody
PPAR antibody was raised in rabbit using Synthetic Peptide: I(484) K K T E T D M S L H P L L Q(498) as the immunogen.Degré de pureté :Min. 95%ZDHHC16 antibody
ZDHHC16 antibody was raised using the C terminal of ZDHHC16 corresponding to a region with amino acids VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGDegré de pureté :Min. 95%CX43 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth and prevents transcription and replication. The potency of this drug has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.PRR5 antibody
PRR5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGSDegré de pureté :Min. 95%SLC35A5 antibody
SLC35A5 antibody was raised using the N terminal of SLC35A5 corresponding to a region with amino acids LVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIKKDHQSRNLKYDegré de pureté :Min. 95%GAPVD1 antibody
GAPVD1 antibody was raised using the N terminal of GAPVD1 corresponding to a region with amino acids FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQC10ORF83 antibody
C10ORF83 antibody was raised using the middle region of C10Orf83 corresponding to a region with amino acids FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTAKLF14 antibody
KLF14 antibody was raised in rabbit using the N terminal of KLF14 as the immunogen
Degré de pureté :Min. 95%IMPDH2 antibody
IMPDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLFRNF125 antibody
RNF125 antibody was raised using the middle region of RNF125 corresponding to a region with amino acids ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHMTCH2 antibody
MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV
HDLBP antibody
HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK
Mitofusin 2 antibody
Mitofusin 2 antibody was raised using the N terminal of MFN2 corresponding to a region with amino acids STVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT
Degré de pureté :Min. 95%Goat anti Rabbit IgG (H + L) (rhodamine)
This antibody reacts with heavy (gamma) chains on rabbit IgG.Degré de pureté :Min. 95%GOLM1 antibody
The GOLM1 antibody is a powerful tool in the field of Life Sciences. It is an anti-MERTK antibody that has been extensively studied for its antiviral and cytotoxic properties. This monoclonal antibody specifically targets the GOLM1 protein, also known as Golgi membrane protein 1, which plays a crucial role in various cellular processes.Histone H4 antibody
The Histone H4 antibody is a valuable tool in the field of Life Sciences. This monoclonal antibody specifically targets and inhibits the acetylation of human folate, which plays a crucial role in various cellular processes. It has been shown to neutralize the activity of interferon and exhibit potent inhibitory effects on 3-kinase.Degré de pureté :Min. 95%LIMK1 antibody
The LIMK1 antibody is a highly effective medicament used in immunoassays. It belongs to the class of Monoclonal Antibodies and is widely used in the field of Life Sciences. This antibody specifically targets and binds to LIMK1, a phosphatase that plays a crucial role in cell growth and migration. By binding to LIMK1, this antibody inhibits its activity and disrupts the signaling pathways associated with growth factors and tyrosine kinase receptors.MMP9 antibody
MMP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%GTF3C5 antibody
GTF3C5 antibody was raised in rabbit using the C terminal of GTF3C5 as the immunogenDegré de pureté :Min. 95%ZNF580 antibody
ZNF580 antibody was raised in rabbit using the N terminal of ZNF580 as the immunogenDegré de pureté :Min. 95%MTHFD1 antibody
MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD
STAT5B antibody
STAT5B antibody was raised in Mouse using a purified recombinant fragment of human STAT5B expressed in E. coli as the immunogen.C9ORF127 antibody
C9ORF127 antibody was raised using the C terminal Of C9Orf127 corresponding to a region with amino acids FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICASPLSCR1 antibody
The PLSCR1 antibody is a monoclonal antibody that specifically targets the PLSCR1 protein. This antibody has been widely used in various life science assays to study the function and regulation of PLSCR1. It is particularly useful in studying the role of PLSCR1 in natriuretic signaling, as well as its interactions with other proteins such as protein kinases and growth factors.BSG antibody
The BSG antibody is a highly reactive monoclonal antibody that is used for ultrasensitive detection in immunoassays and bioassays. It specifically targets the recombinant antigen found in human serum, making it ideal for diagnostic purposes in the field of Life Sciences. With its ability to detect even trace amounts of the target antigen, this antibody offers a reliable and accurate method for detecting intraocular diseases and other conditions. The BSG antibody utilizes electrochemical impedance spectroscopy, which allows for rapid and precise measurements using an electrode-based system. In addition to its diagnostic applications, this antibody has also been shown to have potential therapeutic benefits due to its ability to inhibit epidermal growth factor signaling, collagen production, and other cellular processes.ITIH1 antibody
The ITIH1 antibody is a highly activated and cytotoxic monoclonal antibody that is used in the field of Life Sciences. It specifically targets and neutralizes the effects of teriparatide, TNF-α, interleukin-6, oral haloperidol, dopamine, interferon, and other proteins involved in various biological processes. This antibody has been extensively studied and proven to effectively disrupt protein complexes and inhibit their functions. Whether you're conducting research or developing therapeutic interventions, the ITIH1 antibody is an indispensable tool for understanding and modulating complex biological pathways. Trust in its specificity and potency to advance your scientific endeavors.Normal Donkey Serum
Normal Donkey Serum is a versatile product widely used in various applications in the fields of Veterinary Applications and Life Sciences. It serves as an essential component for the development of antibodies, chemokines, interferons, and other important proteins. Normal Donkey Serum is derived from donkeys and contains a high concentration of globulins, which are crucial for neutralizing antigens and promoting immune responses.Degré de pureté :Min. 95%PPP2R1A antibody
PPP2R1A antibody was raised using a synthetic peptide corresponding to a region with amino acids NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLFIBCD1 antibody
FIBCD1 antibody was raised using the C terminal of FIBCD1 corresponding to a region with amino acids DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYDegré de pureté :Min. 95%LYCAT antibody
LYCAT antibody was raised using the middle region of LYCAT corresponding to a region with amino acids YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNEDegré de pureté :Min. 95%160 kDa Neurofilament antibody
159 kDa Neurofilament antibody was raised in mouse using Neurofilament preparation isolated from calf brain tissue as the immunogen.NHEDC2 antibody
NHEDC2 antibody was raised using the C terminal of NHEDC2 corresponding to a region with amino acids IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILIDegré de pureté :Min. 95%PTGER2 antibody
PTGER2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%FAM19A4 antibody
FAM19A4 antibody was raised using the middle region of FAM19A4 corresponding to a region with amino acids SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVADegré de pureté :Min. 95%Factor VII protein
Factor VII protein is a native protein that plays a crucial role in the blood clotting process. It is involved in the activation of factors IX and X, which are essential for the formation of a stable blood clot. Factor VII protein can be used as a diagnostic tool to detect autoantibodies or monitor the effectiveness of therapies such as trastuzumab or insulin antibody. Additionally, it has been shown to have growth factor-like properties and can stimulate the production of proteins such as fibrinogen and natriuretic peptides. This makes Factor VII protein a valuable tool in life sciences research and applications related to thrombosis, coagulation disorders, and epidermal growth factor signaling pathways.Degré de pureté :Min. 95%CD5 antibody
CD5 antibody is a highly reactive monoclonal antibody that targets the CD5 protein, which is expressed on the surface of certain immune cells. This antibody specifically binds to CD5 and inhibits the activity of protein tyrosine kinases, which play a crucial role in cell signaling and immune response regulation. CD5 antibody can be used in various applications in life sciences, including research and diagnostics. It has been extensively studied for its potential therapeutic use in treating autoimmune diseases and certain types of cancer. The cytotoxic potency of this antibody makes it a promising candidate for targeted therapy, as it can selectively kill CD5-expressing cells while sparing healthy cells. With its high specificity and affinity, CD5 antibody offers researchers a valuable tool to study the function and behavior of CD5-positive cells in different biological contexts.Gentamicin antibody
The Gentamicin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes the activity of Gentamicin, an antibiotic commonly used to treat bacterial infections. This antibody has been extensively studied and proven to effectively inhibit the function of Gentamicin by binding to its surface antigen. By doing so, it prevents the antibiotic from interacting with its intended target, thereby reducing its efficacy.CYP2A7 antibody
CYP2A7 antibody was raised using the N terminal of CYP2A7 corresponding to a region with amino acids MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN
Degré de pureté :Min. 95%Transferrin antibody (FITC)
Transferrin antibody (FITC) was raised in rabbit using human transferrin as the immunogen.PQLC1 antibody
PQLC1 antibody was raised using the middle region of PQLC1 corresponding to a region with amino acids TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMWDegré de pureté :Min. 95%
