Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.014 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
PGM3 antibody
PGM3 antibody was raised using the N terminal of PGM3 corresponding to a region with amino acids IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLGPN2 antibody
GPN2 antibody was raised using the middle region of GPN2 corresponding to a region with amino acids VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSNACP1 antibody
ACP1 antibody was raised using the middle region of ACP1 corresponding to a region with amino acids NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATPH2 antibody
TPH2 antibody was raised using the middle region of TPH2 corresponding to a region with amino acids KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
FER1L3 antibody
FER1L3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDMDegré de pureté :Min. 95%URP1 antibody
URP1 antibody was raised in rabbit using residues 643-660 (VHEYIGGYIFLSTRSKDQ) of the 77 kDa human URP1 protein as the immunogen.Degré de pureté :Min. 95%EIF1AY antibody
The EIF1AY antibody is a highly specialized antibody used in life sciences research. It is a polyclonal antibody that specifically targets the EIF1AY protein, which is an important biomarker in various biological processes. This antibody is designed to detect and bind to the EIF1AY protein, allowing researchers to study its expression and function in different cell types and tissues. With its high specificity and sensitivity, the EIF1AY antibody is an invaluable tool for scientists studying gene expression, protein synthesis, and other cellular mechanisms. Whether you're conducting basic research or working on drug development, this antibody can provide valuable insights into the intricate workings of biological systems.EGFR antibody
The EGFR antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying the epidermal growth factor receptor (EGFR) and its role in cellular signaling pathways. This monoclonal antibody specifically targets and binds to the activated form of EGFR, inhibiting its function and downstream signaling.CRLF2 antibody
The CRLF2 antibody is a medicine that belongs to the class of Monoclonal Antibodies. It works by blocking the emission of certain signals in the body, which can help in the treatment of various conditions. This antibody specifically targets caveolin-1, a protein involved in cell signaling and regulation. By inhibiting caveolin-1, the CRLF2 antibody can interfere with the condensation of certain molecules and prevent their activity.ALDH3A2 antibody
ALDH3A2 antibody was raised using the C terminal of ALDH3A2 corresponding to a region with amino acids FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGDegré de pureté :Min. 95%ALDH1L1 antibody
The ALDH1L1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the ALDH1L1 antigen, which is involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.Resistin protein
Region of Resistin protein corresponding to amino acids SSKTLCSMEE AINERIQEVA GSLIFRAISS IGLECQSVTS RGDLATCPRG FAVTGCTCGS ACGSWDVRAE TTCHCQCAGM DWTGARCCRV QP.Degré de pureté :Min. 95%ZNF529 antibody
ZNF529 antibody was raised in rabbit using the N terminal of ZNF529 as the immunogenDegré de pureté :Min. 95%SMR3A antibody
SMR3A antibody was raised using the middle region of SMR3A corresponding to a region with amino acids YGPGRIPPSPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFPDegré de pureté :Min. 95%Rab10 antibody
Rab10 antibody was raised in rabbit using the C terminal of Rab10 as the immunogenDegré de pureté :Min. 95%TOM1 antibody
TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGASNRPB antibody
SNRPB antibody was raised using the middle region of SNRPB corresponding to a region with amino acids LRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPTNFRSF11B antibody
TNFRSF11B antibody was raised in rabbit using the N terminal of TNFRSF11B as the immunogenDegré de pureté :Min. 95%TACI protein
Region of TACI protein corresponding to amino acids MSGLGRSRRG GRSRVDQEER FPQGLWTGVA MRSCPEEQYW DPLLGTCMSC KTICNHQSQR TCAAFCRSLS CRKEQGKFYD HLLRDCISCA SICGQHPKQC AYFCENKLRS PVNLPPELRR QRSGEVENNS DNSGRYQGLE HRGSEASPAL PGLKLSADQV.Degré de pureté :Min. 95%ACLY Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACLY antibody, catalog no. 70R-3942Degré de pureté :Min. 95%IGF1R antibody
The IGF1R antibody is a highly specialized product in the field of Life Sciences. It specifically targets the growth factor-1 receptor, which plays a crucial role in cellular growth and development. This antibody has been extensively studied and proven to be effective in various assays and experiments.BTK antibody
The BTK antibody is a specific monoclonal antibody that targets Bruton's tyrosine kinase (BTK). It is commonly used in the field of Life Sciences for research purposes. BTK is an important protein kinase involved in various cellular processes, including the development and activation of immune cells. This antibody specifically binds to BTK, inhibiting its activity and interfering with downstream signaling pathways.AHSG protein
AHSG protein is a cytotoxic protein that belongs to the group of Proteins and Antigens. It is commonly used in research as a recombinant protein and has been shown to have neutralizing effects on colony-stimulating factors. AHSG protein can also act as a phosphatase, regulating cellular signaling pathways. This protein has potential therapeutic applications as an immunosuppressant and has been studied for its ability to inhibit the activity of calmodulin. In human serum, AHSG protein exists as dimers and can be detected using monoclonal antibodies. With its diverse range of properties, AHSG protein is a valuable tool in life sciences research.Degré de pureté :Min. 95%Nafamostat
CAS :Nafamostat is a non-peptide inhibitor of the enzyme myeloperoxidase that is involved in the inflammatory response. It has been shown to be effective in treating bowel diseases, such as ulcerative colitis and Crohn's disease, which are characterized by an overproduction of nitric oxide. Nafamostat also inhibits polymorphonuclear leucocytes, which are phagocytic cells that mediate inflammation by releasing reactive oxygen species. Nafamostat has been shown to impair brain functions and cause amnesia in mice when administered intraperitoneally. This drug binds to the toll-like receptor 4 (TLR4) in mouse monoclonal antibody, leading to inhibition of TLR4 signalling and subsequent inhibition of cytokine production by eosinophils. The pharmacological effects of nafamostat are mediated through its ability to inhibit dextran sulfate reductase, an enzyme that catalyzes theFormule :C19H17N5O2Degré de pureté :Min. 95%Masse moléculaire :347.4 g/molGOT2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for its growth. This bactericidal activity is achieved through its ability to bind to DNA-dependent RNA polymerase, effectively inhibiting transcription and replication processes in the bacteria. The efficacy of this drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its specificity towards Mycobacterium tuberculosis strains makes it a potent weapon against this infectious disease.Pax5 antibody
The Pax5 antibody is a highly effective monoclonal antibody that targets mesothelin, a protein associated with various cancers. It is widely used in Life Sciences research and has been shown to inhibit the growth of cancer cells by blocking the oncostatin signaling pathway. This antibody specifically binds to mesothelin and prevents its interaction with other proteins, thereby inhibiting tumor growth. Additionally, the Pax5 antibody has been used in studies to detect serum albumin protein and osteopontin levels in cancer patients. It has also been shown to enhance the effects of chemotherapy drugs like taxol by increasing their efficacy against cancer cells. Furthermore, this antibody has potential applications in Alzheimer's disease research as it can bind to amyloid plaques and reduce glutamate-induced neurotoxicity. The Pax5 antibody has also been found to modulate cellular signaling pathways by activating β-catenin and promoting e-cadherin expression. Overall, this high-quality monoclonal antibody offers great promise for both diagnostic
Degré de pureté :Min. 95%Grp78 antibody
Grp78 antibody was raised in rabbit using a synthetic peptide corresponding to the sequence near the C-terminus of rat Grp78 (BiP) as the immunogen.Degré de pureté :Min. 95%GPR68 antibody
GPR68 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%FMO5 antibody
FMO5 antibody was raised using the middle region of FMO5 corresponding to a region with amino acids NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGNDegré de pureté :Min. 95%(-)-OSU 6162
CAS :Dopamine (D2) receptor stabilizerFormule :C15H23NO2SDegré de pureté :Min. 95%Masse moléculaire :281.41 g/molDrebrin antibody
Drebrin antibody was raised in guinea ig using a synthetic human peptide correesponding to residues 254-272 coupled to KHL as the immunogen.Degré de pureté :Min. 95%HTR5A antibody
HTR5A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%NEFM antibody
The NEFM antibody is a monoclonal antibody that targets the hepatocyte growth factor (HGF) and fibronectin, both of which play important roles in tissue development and repair. This antibody has been shown to inhibit the growth of endothelial cells by blocking the binding of VEGF-C and other growth factors to their receptors. Additionally, it has been found to inhibit the activation of β-catenin, a protein involved in cell adhesion and signaling pathways. The NEFM antibody also exhibits phosphatase activity, which may contribute to its anti-growth effects. This versatile antibody can be used in various research applications, including studies on collagen synthesis, tumor angiogenesis, and multidrug resistance mechanisms.Na,K-ATPase alpha 3 antibody
Na,K-ATPase alpha 3 antibody was raised in mouse using canine cardiac microsomes as the immunogen.
Elagolix
CAS :Non-peptide GnRHR hormone receptor antagonistFormule :C32H30F5N3O5Degré de pureté :Min. 95%Masse moléculaire :631.59 g/molMETTL6 antibody
METTL6 antibody was raised using the N terminal of METTL6 corresponding to a region with amino acids QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLSLC30A3 antibody
SLC30A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLGDegré de pureté :Min. 95%Transferrin antibody
Transferrin antibody is a highly specialized antibody used in Life Sciences research. It is available in both polyclonal and monoclonal forms, offering versatile options for various applications. This antibody has the unique ability to neutralize transferrin, a glycoconjugate involved in iron transport. By binding to transferrin, the antibody prevents its activation and subsequent cytotoxic effects.
EXOC4 antibody
EXOC4 antibody was raised using the N terminal of EXOC4 corresponding to a region with amino acids MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEARasa1 antibody
Rasa1 antibody was raised in rabbit using the C terminal of Rasa1 as the immunogen
Degré de pureté :Min. 95%ALOX15B antibody
ALOX15B antibody was raised in rabbit using the middle region of ALOX15B as the immunogenDegré de pureté :Min. 95%CERKL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CERKL antibody, catalog no. 70R-9907Degré de pureté :Min. 95%Toltrazuril antibody
Toltrazuril antibody is a highly effective polyclonal antibody that targets TGF-beta, a key factor in various biological processes. It has been shown to have a neutralizing effect on TGF-beta, inhibiting its activity and preventing the downstream effects it triggers. This antibody also interacts with fatty acids and monoclonal antibodies, further enhancing its therapeutic potential. In addition, Toltrazuril antibody has been found to have an affinity for catecholaminergic neurons and epidermal growth factor, making it a versatile tool in life sciences research. Its ability to bind to chemokines and MCF-7 cells demonstrates its broad applicability in different experimental settings. With its colloidal properties and high efficacy at low doses, Toltrazuril antibody is an invaluable asset for researchers seeking reliable and accurate results.Degré de pureté :Min. 95%ZMAT3 antibody
The ZMAT3 antibody is a polyclonal antibody used in life sciences research. It is designed to specifically bind to the ZMAT3 antigen, which is a serum marker and potential target for antiviral therapies. This antibody can be used in various applications such as immunohistochemistry and western blotting to detect the presence of ZMAT3 in different tissues or cell types. The binding of the ZMAT3 antibody to its target can provide valuable insights into the role of ZMAT3 in cellular processes such as interleukin signaling and extracellular matrix regulation. Researchers can also use this antibody as part of their studies on affinity binders, chemotherapy, sirtuins, or autoantibodies. With its high specificity and sensitivity, the ZMAT3 antibody is an essential tool for scientists working in the field of life sciences and developing new medicaments or medicines.IL28R alpha antibody
IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFDegré de pureté :Min. 95%Brgl antibody
The Brgl antibody is a monoclonal antibody that targets chemokine receptors and inhibits their activity. It has been shown to effectively block the binding of chemokines to their receptors, preventing the activation of downstream signaling pathways. This antibody is also able to bind to alpha-fetoprotein (AFP), a protein that is often elevated in certain types of cancer. By targeting AFP, the Brgl antibody can potentially inhibit the growth and spread of cancer cells. Additionally, this antibody has been found to be a potent family kinase inhibitor, blocking the activity of various kinases involved in cell signaling and proliferation. The Brgl antibody can be used in research settings as well as in the development of immunogenic compositions and polymers for targeted drug delivery. Its high specificity and affinity make it a valuable tool in Life Sciences research.
SRPX2 antibody
The SRPX2 antibody is a powerful tool used in immunofluorescence studies. It is a polyclonal antibody that specifically targets SRPX2, a protein involved in various cellular processes. This antibody can be used to detect and visualize SRPX2 in cells and tissues, making it an essential tool for researchers in the life sciences field.BAT5 antibody
BAT5 antibody was raised using the N terminal of BAT5 corresponding to a region with amino acids VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRKDegré de pureté :Min. 95%ZEB2 antibody
The ZEB2 antibody is a polyclonal antibody that is widely used in various assays in the field of Life Sciences. It specifically targets ZEB2, a glycoprotein that plays a crucial role in cellular processes. This antibody has been extensively studied and proven to be an effective tool for research purposes.Degré de pureté :Min. 95%Helicobacter pylori protein
Helicobacter pylori protein is a bioassay that utilizes monoclonal antibodies to detect the presence of this specific protein. It is commonly used in Life Sciences research to study the role of Helicobacter pylori in various diseases and conditions. This protein has been found to be associated with platinum-based chemotherapy resistance, as well as increased levels of interleukin-6, calpain, and galectin-3-binding. Additionally, it has been shown to interact with ergosterol, a key component of fungal cell membranes. Monoclonal antibodies targeting this protein can be used in immunoassays for detection and quantification purposes. The isolated nucleic acid of Helicobacter pylori protein can also be utilized in research studies focused on understanding its genetic characteristics and potential therapeutic targets. Native Proteins & Antigens offers high-quality products related to this protein, ensuring accurate and reliable results for your scientific investigations.Degré de pureté :Min. 95%POLR3A antibody
POLR3A antibody was raised using the middle region of POLR3A corresponding to a region with amino acids AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDTFLIP antibody
FLIP antibody was raised in mouse using recombinant human FLIP (1-376aa) purified from E. coli as the immunogen.C1ORF159 antibody
C1ORF159 antibody was raised using the middle region of C1Orf159 corresponding to a region with amino acids GQSQGALWVCPQTGLPGSGSRPPLPGSPGDPPTRQGQGRIWLVPPALDLSDegré de pureté :Min. 95%ZNF251 antibody
ZNF251 antibody was raised in rabbit using the middle region of ZNF251 as the immunogenDegré de pureté :Min. 95%GPR151 antibody
The GPR151 antibody is a monoclonal antibody that specifically targets the human mitochondrial protein GPR151. This protein is involved in various cellular processes, including epidermal growth factor signaling and regulation of cell proliferation. The GPR151 antibody can be used in Life Sciences research, particularly in the study of mitochondrial function and signaling pathways.MBP antibody
The MBP antibody is a drug antibody that specifically targets and binds to the myelin basic protein (MBP). This protein plays a crucial role in the structure and function of myelin, which is essential for proper nerve conduction. The MBP antibody is available as both polyclonal antibodies and monoclonal antibodies.Degré de pureté :Min. 95%PHF11 antibody
PHF11 antibody was raised in rabbit using the n terminal of PHF11 as the immunogenDegré de pureté :Min. 95%RNF169 antibody
RNF169 antibody was raised using the N terminal of RNF169 corresponding to a region with amino acids DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHRADAM30 antibody
ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIHDegré de pureté :Min. 95%ACBD5 antibody
ACBD5 antibody was raised using the N terminal of ACBD5 corresponding to a region with amino acids ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKDegré de pureté :Min. 95%Troponin I protein (Cardiac) (Dog)
Purified native Dog Troponin I protein (Cardiac)Degré de pureté :≥95% By Sds Page.CIRE antibody
The CIRE antibody is a monoclonal antibody that specifically targets actin filaments. It has been widely used in the field of Life Sciences for various applications. This antibody has shown high affinity towards actin, a protein involved in cell structure and movement. By binding to actin, the CIRE antibody can modulate cellular processes such as cell division and migration.BECN1 antibody
The BECN1 antibody is a monoclonal antibody that specifically targets and binds to the influenza hemagglutinin glycoprotein. This antibody has been shown to activate phosphatase activity, which plays a crucial role in regulating various cellular processes. Additionally, the BECN1 antibody has been found to interact with fibrinogen and modulate its function.Mizagliflozin
CAS :Mizagliflozin is an experimental drug that inhibits sodium-dependent glucose uptake in the intestine. It is being developed for use in the treatment of type 2 diabetes and obesity. Mizagliflozin has been shown to reduce blood sugar levels, body weight, and insulin resistance in rats with diet-induced obesity. The drug has been found to be well tolerated in clinical trials so far. Mizagliflozin does not cause hypoglycemia or increase the risk of heart attack or stroke. Mizagliflozin has a low potential for abuse and is not addictive. This drug also does not cause constipation like other common antidiabetic drugs. Mizagliflozin has been shown to work by binding to tyrosine phosphatases (TP), which are enzymes that regulate cellular processes such as cell growth, differentiation, and motility. This binding prevents TP from dephosphorylating phosphotyrosine residues on proteins such as insulin receptor substrate 1Formule :C28H44N4O8Degré de pureté :Min. 95%Masse moléculaire :564.7 g/molCACNB2 antibody
CACNB2 antibody was raised in rabbit using the C terminal of CACNB2 as the immunogenDegré de pureté :Min. 95%
