Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.015 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 186-192 of cTnI as the immunogen.SLC22A18 antibody
SLC22A18 antibody was raised using the N terminal of SLC22A18 corresponding to a region with amino acids AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLGDegré de pureté :Min. 95%TRIM2 antibody
The TRIM2 antibody is a monoclonal antibody that specifically targets collagen. It is widely used in the field of Life Sciences for its neutralizing properties. This antibody has been extensively studied and proven to effectively bind to its target, making it a valuable tool in research and diagnostics. The TRIM2 antibody recognizes a conformational epitope on collagen, allowing for precise and accurate detection. It has also been shown to have cytotoxic effects on low-density cells, further highlighting its potential therapeutic applications. With its high specificity and reliability, the TRIM2 antibody is an essential component in various scientific experiments and studies.SLC5A10 antibody
SLC5A10 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%SP1 antibody
The SP1 antibody is a monoclonal antibody that is commonly used in Life Sciences research. It specifically targets and binds to the SP1 protein, which is a transcription factor involved in regulating gene expression. This antibody has been extensively studied and validated for its specificity and sensitivity in detecting SP1 protein in various experimental settings.Degré de pureté :Min. 95%CENPQ antibody
CENPQ antibody was raised using the N terminal of CENPQ corresponding to a region with amino acids VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHLSTAT5B antibody
STAT5B antibody was raised in rabbit using the N terminal of STAT5B as the immunogenDegré de pureté :Min. 95%XIAP antibody
The XIAP antibody is a monoclonal antibody that specifically targets the X-linked inhibitor of apoptosis protein (XIAP). This protein plays a crucial role in regulating cell death and survival pathways. The XIAP antibody has been extensively studied and proven to be highly effective in neutralizing the function of XIAP, thereby promoting apoptosis in cancer cells.
HSD3B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HSD3B1 antibody, catalog no. 70R-7092Degré de pureté :Min. 95%Lidocaine antibody
The Lidocaine antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets lidocaine, a commonly used local anesthetic and antiarrhythmic drug. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.Degré de pureté :Min. 95%Pax5 antibody
Pax5 antibody is a monoclonal antibody that is widely used in the field of life sciences. It specifically targets Pax5, a protein involved in B-cell development and differentiation. This antibody has been shown to have cytotoxic effects on B-cells, leading to their destruction. In addition, Pax5 antibody has antiviral properties and can inhibit the growth of viruses such as mycoplasma genitalium. Furthermore, this antibody can block the activity of certain growth factors, including epidermal growth factor, which are involved in cell proliferation and differentiation. Overall, Pax5 antibody is a valuable tool for researchers studying B-cell biology and its role in various diseases.FH antibody
FH antibody is a monoclonal antibody that targets the protein complex involved in the cytotoxic effects of oral haloperidol. It specifically binds to ornithine, reducing its viscosity and preventing the formation of toxic metabolites. FH antibody also interacts with the nuclear receptor, inhibiting its glycosylation and subsequent activation of interleukin-6 and interferon pathways. This monoclonal antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic option for patients experiencing adverse effects from haloperidol treatment. Additionally, FH antibody does not interact with dopamine or mineralocorticoid receptors, minimizing the risk of unwanted side effects.TRHR antibody
TRHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%SLC5A9 antibody
SLC5A9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%Rotavirus antibody
Rotavirus antibody was raised in mouse using p41 capsid protein of monkey, porcine and human isolates as the immunogen.CRP antibody
The CRP antibody is a monoclonal antibody that specifically targets pancreatic glucagon and glucagon-like peptide-1 (GLP-1). It is widely used in life sciences research and assays to detect and measure the levels of these hormones. The CRP antibody has high affinity and specificity for its target, allowing for accurate and reliable results. It can be used in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry. Additionally, the CRP antibody has been shown to have potential therapeutic uses in the treatment of diabetes and other metabolic disorders. With its ability to detect and quantify pancreatic hormones, this monoclonal antibody is an invaluable tool in both research and clinical settings.Mouse Lymphocyte antibody
Mouse lymphocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.
Degré de pureté :Min. 95%TNFSF18 antibody
TNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNDegré de pureté :Min. 95%WDR40A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDR40A antibody, catalog no. 70R-3536Degré de pureté :Min. 95%MUC1 antibody
MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMDegré de pureté :Min. 95%KLF7 antibody
The KLF7 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the pleomorphic adenoma gene 3 (PLAG3), which plays a crucial role in cell growth and proliferation. This antibody can be used to study the activation of epidermal growth factor receptor (EGFR) signaling pathways, as well as the regulation of mitogen-activated protein kinase (MAPK) signaling. The KLF7 antibody is highly specific and has been validated for use in various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is an essential tool for researchers studying neuronal development, cardiomyocyte differentiation, and other cellular processes. With its high specificity and reliability, the KLF7 antibody provides accurate and reproducible results in experiments.CCDC70 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC70 antibody, catalog no. 70R-3115Degré de pureté :Min. 95%CD138 antibody
The CD138 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the EBNA1 protein, which is involved in glycosylation and cholinergic signaling. This antibody can be used to study the function and regulation of EBNA1, as well as its interactions with other proteins and molecules. Additionally, the CD138 antibody has been shown to inhibit interferon and interleukin-6 signaling pathways, making it a valuable tool for studying immune responses and inflammation. Its high specificity and affinity make it an ideal choice for experiments requiring accurate detection of EBNA1 or related proteins. Whether you're studying autoantibodies, plasmids, or glycation processes, the CD138 antibody is an essential reagent for your research needs.
BDP1 antibody
BDP1 antibody was raised in mouse using recombinant Human B Double Prime 1, Subunit Of Rna Polymeraseiii Transcription Initiation Factor Iiib (Bdp1)Prepro-Neuropeptide Y antibody
Prepro-neuropeptide Y antibody was raised in rabbit using a synthetic Prepro-NPY 68-97 (C-PON) as the immunogen.Degré de pureté :Min. 95%TDO2 antibody
TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
OSM antibody
The OSM antibody is a highly effective monoclonal antibody that specifically targets oncostatin M (OSM), a biochemical involved in various cellular processes. This antibody has been extensively studied and proven to be highly specific and potent in inhibiting the activity of OSM. It is widely used in Life Sciences research as a valuable tool for studying the role of OSM in different biological systems.
Troponin I antibody (Dephospho) (Cardiac)
Troponin I antibody (Phospho/Cardiac) was raised in mouse using a phosphorylated form of human TnC as the immunogen.VASP antibody
The VASP antibody is a highly effective monoclonal antibody that acts as an antibiotic and growth factor in various biological processes. It specifically targets the vasodilator-stimulated phosphatase (VASP), which plays a crucial role in regulating actin dynamics and cell migration. This antibody can be used for both research and diagnostic purposes, providing valuable insights into cellular signaling pathways and protein interactions.KCNJ9 antibody
KCNJ9 antibody was raised using the middle region of KCNJ9 corresponding to a region with amino acids CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARDegré de pureté :Min. 95%Phenobarbital antibody
Phenobarbital antibody was raised in mouse using phenobarbital conjugated to KLH as the immunogen.KIR2DS4 protein
MEGVHRKPSF LALPGHLVKS EETVILQCWS DVMFEHFLLH REGKFNNTLH LIGEHHDGVS KANFSIGPMM PVLAGTYRCY GSVPHSPYQL SAPSDPLDMV IIGLYEKPSL SAQPGPTVQA GENVTLSCSS RSSYDMYHLS REGEAHERRL PAVRSINGTF QADFPLGPAT HGGTYRCFGS FRDAPYEWSN SSDPLLVSVT GNDegré de pureté :Min. 95%WDR6 antibody
WDR6 antibody was raised using the C terminal of WDR6 corresponding to a region with amino acids TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEENPP6 antibody
ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWSDegré de pureté :Min. 95%CKMM antibody
CKMM antibody was raised using the middle region of CKM corresponding to a region with amino acids GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIFGD1 antibody
FGD1 antibody was raised in rabbit using the C terminal of FGD1 as the immunogenDegré de pureté :Min. 95%ZNF660 antibody
ZNF660 antibody was raised in rabbit using the N terminal of ZNF660 as the immunogenDegré de pureté :Min. 95%KIAA1191 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1191 antibody, catalog no. 70R-4448Degré de pureté :Min. 95%MRPL39 antibody
MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTOR1A1 antibody
The OR1A1 antibody is a polyclonal antibody that specifically targets antiphospholipid antibodies. It has been shown to have high affinity and specificity for these autoantibodies, making it an effective tool for research and diagnostic purposes. The OR1A1 antibody can be used in various applications such as immunohistochemistry, western blotting, and ELISA assays. It has also been used to study the role of antiphospholipid antibodies in diseases such as collagen vascular diseases, thrombosis, and pregnancy complications. This antibody is produced using advanced techniques in the field of life sciences and undergoes rigorous quality control measures to ensure its performance and reliability. With its ability to detect a wide range of target antigens including alpha-fetoprotein, erythropoietin, tnf-related apoptosis-inducing ligand (TRAIL), basic protein, osteopontin, and steroids, the OR1A1 antibody is a valuable tool for researchers inSCG3 antibody
The SCG3 antibody is a powerful substance that inhibits the activity of specific nucleotides. This polyclonal antibody is widely used in analytical and life sciences research to study the function and interactions of various proteins and ligands. By binding to specific targets, the SCG3 antibody can effectively inhibit their activity, providing valuable insights into cellular processes and signaling pathways. With its high specificity and potency, this antibody is an essential tool for researchers seeking to understand the intricate mechanisms of protein function.
EIF2S2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2S2 antibody, catalog no. 70R-4905Degré de pureté :Min. 95%SEMA6D antibody
SEMA6D antibody was raised using the N terminal of SEMA6D corresponding to a region with amino acids VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLYDegré de pureté :Min. 95%PTPRR antibody
PTPRR antibody was raised using the N terminal of PTPRR corresponding to a region with amino acids TATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKV
Degré de pureté :Min. 95%ATP10D antibody
ATP10D antibody was raised using the C terminal of ATP10D corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDADegré de pureté :Min. 95%ST6GALNAC6 antibody
ST6GALNAC6 antibody was raised using the C terminal of ST6GALNAC6 corresponding to a region with amino acids YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP
Degré de pureté :Min. 95%Profilin 1 antibody
Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLCRYAB antibody
The CRYAB antibody is a monoclonal antibody that specifically targets the colony-stimulating factor known as GM-CSF. This antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent. It acts by neutralizing the activity of GM-CSF, which is responsible for promoting the growth and activation of various immune cells.UCP4 antibody
UCP4 antibody was raised in rabbit using a 16 amino acid peptide from human UCP4 as the immunogen.Degré de pureté :Min. 95%OTX2 antibody
The OTX2 antibody is a highly specialized monoclonal antibody that targets a specific molecule involved in growth factor signaling. It is widely used in Life Sciences research for its neutralizing properties and ability to block the activity of this target molecule. This antibody has been extensively studied and proven to be effective in inhibiting the function of the target molecule, leading to important discoveries in various fields of research.CD49f antibody
The CD49f antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that exhibits both antiangiogenic and cytotoxic properties. This antibody specifically targets and binds to CD49f, which is an activated growth factor receptor found on the surface of cells. By binding to CD49f, the antibody inhibits the signaling pathway that promotes angiogenesis and cell growth.
Pyruvate Dehydrogenase antibody (C-terminus)
Mouse monoclonal Pyruvate Dehydrogenase antibody (C-terminus)
Keratin 7 antibody
The Keratin 7 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. This antibody specifically targets the tyrosine residues on Keratin 7, which is a protein found in the epithelial cells of various tissues. By binding to these residues, the Keratin 7 antibody promotes cell growth and differentiation.Degré de pureté :Min. 95%QPCT antibody
QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA
Degré de pureté :Min. 95%5-(Azepan-2-ylidene)-2,2-dimethyl-1,3-dioxane-4,6-dione
CAS :Produit contrôlé5-(Azepan-2-ylidene)-2,2-dimethyl-1,3-dioxane-4,6-dione is a synthetic chemical compound known for its role as a biochemical intermediate. This compound is synthesized through a controlled chemical process involving the reaction of relevant precursors under specific conditions, typically in a laboratory setting, making it an artificial construct rather than a naturally occurring substance.Formule :C12H17NO4Degré de pureté :Min. 95%Masse moléculaire :239.27 g/molCCP2 antibody
The CCP2 antibody is a highly specialized and potent intracellular antibody that targets a specific growth factor. This glycopeptide antibody is designed to neutralize the activity of the growth factor, preventing its binding to receptors and subsequent signaling pathways. The CCP2 antibody is a polyclonal antibody, meaning it is derived from multiple sources and recognizes multiple epitopes on the target molecule. It is produced using state-of-the-art techniques in Life Sciences research.Degré de pureté :Min. 95%MTO1 antibody
MTO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV
