Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.015 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.371 produits)
130589 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SIGLEC7 antibody
SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLDegré de pureté :Min. 95%CYP2A6 antibody
The CYP2A6 antibody is a polyclonal antibody that specifically targets the CYP2A6 protein. This protein is a member of the cytochrome P450 family and plays a crucial role in drug metabolism. The CYP2A6 antibody can be used for various applications, including research on growth factors, antibodies, and cytotoxicity. It has been widely used in studies involving serum albumin protein, monoclonal antibodies, cytotoxic conjugates, basic proteins, and human serum. Additionally, this antibody has shown inhibitory effects on EGF-like glycosylation and can be used in the development of anti-CD20 antibodies and autoantibodies. Its high specificity and affinity make it an excellent tool for studying the function and regulation of the CYP2A6 protein.Degré de pureté :Min. 95%E2F2 antibody
E2F2 antibody was raised in mouse using recombinant Human E2F Transcription Factor 2 (E2F2)
CD3E antibody
The CD3E antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and neutralizes alpha-fetoprotein, a protein complex found in human serum. The CD3E antibody has been extensively studied for its binding properties to steroid binding proteins, particularly those involved in nuclear receptor signaling pathways. This antibody is known for its high affinity and specificity, making it an ideal tool for research and diagnostic applications. Whether you are studying protein-protein interactions or investigating the role of specific molecules in cellular processes, the CD3E antibody is an essential tool in your arsenal. Trust this monoclonal antibody to deliver accurate and reliable results for all your scientific endeavors.Chlorpromazine antibody
The Chlorpromazine antibody is a highly specialized monoclonal antibody that specifically targets and binds to chlorpromazine, a metal-binding protein. This multispecific antibody is designed to recognize and bind to specific lysine and acid residues on chlorpromazine molecules. The Chlorpromazine antibody can be used in various applications, such as immunohistochemistry, flow cytometry, and Western blotting.Degré de pureté :Min. 95%DLAT antibody
The DLAT antibody is a highly specialized monoclonal antibody that has been developed for use in various life sciences applications. It is designed to specifically target and bind to DLAT, also known as dihydrolipoamide S-acetyltransferase. This protein plays a crucial role in the function of the pyruvate dehydrogenase complex, which is involved in energy metabolism.PRKX antibody
PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDT and B cell activation antigen antibody (biotin)
Rat monoclonal T and B cell activation antigen antibody (biotin)TYRO3 antibody
The TYRO3 antibody is a monoclonal antibody that is widely used in the field of life sciences. It has neutralizing properties and can effectively bind to specific antigens, thereby inhibiting their activity. This antibody has been extensively studied and proven to be highly effective in various research applications.LST-3TM12 antibody
LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLHDegré de pureté :Min. 95%FAM19A3 antibody
FAM19A3 antibody was raised using the middle region of FAM19A3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGVDegré de pureté :Min. 95%CHI3L2 protein
The CHI3L2 protein is a growth factor inhibitor that is commonly used in the field of Life Sciences. It belongs to the class of Conjugated Proteins and can be targeted using monoclonal antibodies. CHI3L2 has been shown to inhibit the activity of oncostatin, sorafenib, and interferon, making it an effective antiangiogenic agent. Additionally, this protein has neutralizing properties and can prevent hemolysis. Its ability to inhibit endothelial growth makes it a valuable tool in research and therapeutic applications. When purchasing CHI3L2 protein, make sure to check for the presence of any excipients that may affect its stability or activity.Degré de pureté :Min. 95%B3GALT1 antibody
B3GALT1 antibody was raised using the N terminal of B3GALT1 corresponding to a region with amino acids MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFDegré de pureté :Min. 95%GALNT5 antibody
GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAEDegré de pureté :Min. 95%SERPINA1 antibody
The SERPINA1 antibody is a monoclonal antibody used in the field of life sciences. It specifically targets alpha-fetoprotein, a family kinase inhibitor that plays a crucial role in various cellular processes. The antibody has been extensively studied and shown to effectively neutralize the growth factor activity of alpha-fetoprotein.RHOBTB1 antibody
RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWNDegré de pureté :Min. 95%Troponin I antibody (Skeletal Muscle)
Troponin I antibody (skeletal Muscle) was raised in mouse using human skTnI as the immunogen.SIGLEC6 antibody
SIGLEC6 antibody was raised using the C terminal of SIGLEC6 corresponding to a region with amino acids IVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Degré de pureté :Min. 95%KLHL1 antibody
KLHL1 antibody was raised in Mouse using a purified recombinant fragment of human KLHL1 expressed in E. coli as the immunogen.CD90 antibody
The CD90 antibody is a monoclonal antibody that targets the CD90 antigen, also known as Thy-1. It is widely used in life sciences research to study various cellular processes and functions. The CD90 antibody specifically binds to actin filaments and has been shown to inhibit flavobacterium growth. Additionally, it can be used in conjunction with other antibodies to detect and quantify the expression of GM-CSF (colony-stimulating factor) binding proteins. This versatile antibody is commonly used in immunohistochemistry, flow cytometry, and western blotting applications. Its high specificity and affinity make it an essential tool for researchers studying cell signaling pathways, immune responses, and tissue regeneration.PIWIL4 antibody
PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRWSCD2 antibody
WSCD2 antibody was raised using the C terminal of WSCD2 corresponding to a region with amino acids GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPRFSHR antibody
The FSHR antibody is a neutralizing antibody that targets the follicle-stimulating hormone receptor (FSHR). It specifically binds to estrogen receptors and inhibits their activity. This antibody is commonly used in Life Sciences research to study hormone peptides, glycans, and tyrosine residues. It is available as both a monoclonal antibody and a polyclonal antibody.STK24 antibody
The STK24 antibody is a highly specialized biomolecule used in Life Sciences research. It is a polyclonal antibody that specifically targets and binds to the STK24 protein, which is involved in various cellular processes such as growth factor signaling and actin filament organization. This antibody can be used in experiments to study the function and regulation of STK24, as well as its interactions with other proteins.WNT1 antibody
The WNT1 antibody is a highly potent and specific monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to target and bind to the WNT1 protein, which plays a crucial role in cellular signaling pathways. By binding to the WNT1 protein, this antibody can effectively inhibit its receptor binding activity, thereby disrupting the formation of protein complexes involved in cell growth and development.Pax5 antibody
The Pax5 antibody is a neutralizing monoclonal antibody that specifically targets the CD33 antigen. It acts as an inhibitor, blocking the activity of CD33 and preventing its interaction with other molecules. This antibody has been shown to be effective in neutralizing the effects of antiphospholipid antibodies, which are associated with autoimmune disorders. Additionally, it has been demonstrated to inhibit tyrosine phosphorylation and the activation of TRPV4 channels. The Pax5 antibody can be used for various applications, including immunohistochemistry and protein kinase studies. Its versatility and specificity make it a valuable tool for researchers in the field of immunology.Caspase-3/7 Inhibitor I
CAS :Caspase-3/7 Inhibitor I is a chemical compound used predominantly in biochemical research, particularly in the study of apoptosis. It is a synthetic, reversible inhibitor derived from known peptide inhibitors of caspase enzymes. The inhibitor functions by blocking the active sites of caspase-3 and caspase-7 enzymes, halting their protease activity, which is crucial in the execution phase of apoptosis.Formule :C14H16N2O5SDegré de pureté :Min. 95%Masse moléculaire :324.35 g/molTHRA antibody
THRA antibody was raised in mouse using recombinant Human Thyroid Hormone Receptor, Alpha (Erythroblastic Leukemia Viral (V-Erb-A) Oncogene Homolog, Avian)TYMS antibody
TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEHantavirus (Puumala) antibody (HRP)
Hantavirus (Puumala) antibody (HRP) was raised in mouse using recombinant Puumala nucleocapsid protein as the immunogen.CYP4B1 antibody
The CYP4B1 antibody is a highly specialized monoclonal antibody that is commonly used in Life Sciences research. It is colloidal in nature and specifically targets the CYP4B1 protein. This monoclonal antibody has been extensively studied and proven to be effective in detecting and quantifying the presence of CYP4B1 in various biological samples.PAX2 antibody
The PAX2 antibody is a highly specific monoclonal antibody that recognizes and binds to the PAX2 protein. This antibody is commonly used in research and diagnostic applications to study the expression and function of PAX2 in various biological processes.Hexokinase 4 protein (His tag)
Purified recombinant Human Hexokinase 4 proteinDegré de pureté :Min. 95%TRIM63 antibody
TRIM63 antibody was raised using the middle region of TRIM63 corresponding to a region with amino acids EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQAnnexin A6 protein (His tag)
1-673 amino acids: MGSSHHHHHH SSGLVPRGSH MAKPAQGAKY RGSIHDFPGF DPNQDAEALY TAMKGFGSDK EAILDIITSR SNRQRQEVCQ SYKSLYGKDL IADLKYELTG KFERLIVGLM RPPAYCDAKE IKDAISGIGT DEKCLIEILA SRTNEQMHQL VAAYKDAYER DLEADIIGDT SGHFQKMLVV LLQGTREEDD VVSEDLVQQD VQDLYEAGEL KWGTDEAQFI YILGNRSKQH LRLVFDEYLK TTGKPIEASI RGELSGDFEK LMLAVVKCIR STPEYFAERL FKAMKGLGTR DNTLIRIMVS RSELDMLDIR EIFRTKYEKS LYSMIKNDTS GEYKKTLLKL SGGDDDAAGQ FFPEAAQVAY QMWELSAVAR VELKGTVRPA NDFNPDADAK ALRKAMKGLG TDEDTIIDII THRSNVQRQQ IRQTFKSHFG RDLMTDLKSE ISGDLARLIL GLMMPPAHYD AKQLKKAMEG AGTDEKALIE ILATRTNAEI RAINEAYKED YHKSLEDALS SDTSGHFRRI LISLATGHRE EGGENLDQAR EDAQVAAEIL EIADTPSGDK TSLETRFMTI LCTRSYPHLR RVFQEFIKMT NYDVEHTIKK EMSGDVRDAF VAIVQSVKNK PLFFADKLYK SMKGAGTDEK TLTRIMVSRS EIDLLNIRRE FIEKYDKSLH QAIEGDTSGD FLKALLALCG GEDDegré de pureté :Min. 95%Bax antibody
The Bax antibody is a highly effective monoclonal antibody that has neutralizing properties. It targets TRPV4, a protein involved in various cellular processes, and inhibits its activity. Additionally, the Bax antibody has been shown to neutralize TNF-α, a pro-inflammatory cytokine that plays a role in immune responses. This antibody is widely used in Life Sciences research and is an essential tool for studying TRPV4 and TNF-α related pathways. It can be utilized in various applications such as immunohistochemistry and endotoxemia studies. With its high specificity and potency, the Bax antibody is a valuable asset for researchers looking to investigate TRPV4 and TNF-α signaling pathways.CD36 antibody
The CD36 antibody is a highly specialized protein monoclonal antibody used in the field of Life Sciences. It specifically targets CD36, a cell surface receptor involved in various cellular processes. This monoclonal antibody has been extensively studied and validated for its specificity and effectiveness.C14ORF101 antibody
C14ORF101 antibody was raised in rabbit using the N terminal of C14ORF101 as the immunogenDegré de pureté :Min. 95%GJC1 antibody
GJC1 antibody was raised using the middle region of GJC1 corresponding to a region with amino acids ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWIDegré de pureté :Min. 95%Beta tubulin antibody
The Beta tubulin antibody is a monoclonal antibody that specifically targets the beta tubulin protein. This antibody has been widely used in research and diagnostics in the field of Life Sciences. It can be used to study various cellular processes, including cell division, intracellular transport, and cytoskeleton organization.TUBB3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been proven through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture.PTGES3 antibody
PTGES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMGHR antibody
GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF
Degré de pureté :Min. 95%CAD antibody
CAD antibody was raised using the C terminal of CAD corresponding to a region with amino acids ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELTOP2A antibody
The TOP2A antibody is a highly specialized product in the field of Life Sciences. It is an anti-ICOS antibody that specifically targets the TOP2A molecule. This antibody plays a crucial role in various biological processes, including the regulation of adiponectin, collagen, and autoantibodies.SGSH antibody
The SGSH antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets oncostatin, a growth factor involved in various cellular processes. The SGSH antibody has shown to have cytotoxic effects on cancer cells by disrupting actin filaments and inhibiting their growth. Additionally, this antibody has been found to interact with other molecules such as anti-CD33 antibodies, osteopontin, taxol, and collagen, further enhancing its therapeutic potential. With its high specificity and potency, the SGSH antibody holds great promise as a targeted therapy against various diseases and is a valuable tool for researchers in the field of molecular biology and biotechnology.NAC1 antibody
The NAC1 antibody is a highly effective tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets NAC1, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting NAC1 dimers.
CSPG4 antibody
The CSPG4 antibody is a monoclonal antibody that targets the growth factor CSPG4. It is used in various research applications to study the role of CSPG4 in different biological processes. This antibody has been shown to be effective in detecting CSPG4 expression in cells and tissues. Additionally, it can be used for immunoprecipitation, Western blotting, and immunofluorescence assays. The CSPG4 antibody has been validated for use in multiple species and is highly specific, exhibiting minimal cross-reactivity with other proteins. Its high affinity and sensitivity make it a valuable tool for researchers studying the function of CSPG4 in various cellular pathways.Phencyclidine antibody
Phencyclidine antibody was raised in mouse using phenocyclidine-BSA as the immunogen.AHCTF1 antibody
AHCTF1 antibody was raised in mouse using recombinant Human At Hook Containing Transcription Factor 1 (Ahctf1)
DOR1 antibody
DOR1 antibody was raised in rabbit using a synthetic peptide comprising residues 3-17 LVPSARAELQSSPLV of the mouse and rat DOR-1 protein as the immunogen.Degré de pureté :Min. 95%Lamin A antibody
The Lamin A antibody is a highly specialized monoclonal antibody that targets the lamin A protein. Lamin A is a key component of the nuclear lamina, which provides structural support to the nucleus and plays a crucial role in various cellular processes. This antibody specifically recognizes and binds to lamin A, allowing for its detection and analysis in different cell types.GLO1 antibody
GLO1 antibody was raised using the N terminal of GLO1 corresponding to a region with amino acids TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKERHBG antibody
RHBG antibody was raised using the C terminal of RHBG corresponding to a region with amino acids LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLGDegré de pureté :Min. 95%SLC18A1 antibody
SLC18A1 antibody was raised in rabbit using the middle region of SLC18A1 as the immunogenDegré de pureté :Min. 95%
