Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.015 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.371 produits)
130589 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
C2orf30 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf30 antibody, catalog no. 70R-4009Degré de pureté :Min. 95%FBXW11 antibody
FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDApoE2 protein
Region of ApoE2 protein corresponding to amino acids MKVEQAVETE PEPELRQQTE WQSGQRWELA LGRFWDYLRW VQTLSEQVQE ELLSSQVTQE LRALMDETMK ELKAYKSELE EQLTPVAEET RARLSKELQA AQARLGADME DVCGRLVQYR GEVQAMLGQS TEELRVRLAS HLRKLRKRLL RDADDLQKCL AVYQAGAREG AERGLSAIRE RLGPLVEQGR VRAATVGSLA GQPLQERAQA WGERLRARME EMGSRTRDRL DEVKEQVAEV RAKLEEQAQQ IRLQAEAFQA RLKSWFEPLV EDMQRQWAGL VEKVQAAVGT SAAPVPSDNH.Degré de pureté :≥ 90% By Sds-Page Gel And Hplc AnalysesCPEB4 antibody
CPEB4 antibody was raised using the N terminal of CPEB4 corresponding to a region with amino acids DEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQGDPCDH1 antibody
PCDH1 antibody was raised using the N terminal of PCDH1 corresponding to a region with amino acids LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVGDegré de pureté :Min. 95%CENPH antibody
CENPH antibody was raised using the N terminal of CENPH corresponding to a region with amino acids MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTDegré de pureté :Min. 95%SF3B14 antibody
SF3B14 antibody was raised using the middle region of SF3B14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPKGABARAP antibody
GABARAP antibody was raised in rabbit using the N terminal of GABARAP as the immunogenDegré de pureté :Min. 95%AATF antibody
The AATF antibody is a monoclonal antibody that targets the AATF protein. It has been shown to be effective in inhibiting the growth of cancer cells, particularly in breast cancer (MCF-7) cells. The AATF antibody works by blocking the interaction between AATF and other proteins involved in cell proliferation and survival, such as adalimumab and interleukin-6. This inhibition leads to a decrease in tumor necrosis factor-alpha (TNF-α) production and ultimately hinders cancer cell growth.MMP15 antibody
The MMP15 antibody is a powerful tool used in Life Sciences research. It specifically targets and neutralizes the activity of matrix metalloproteinase 15 (MMP15), an enzyme involved in various biological processes such as tissue remodeling, wound healing, and cancer progression.GLCCI1 antibody
GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADPRKRA antibody
PRKRA antibody was raised in mouse using recombinant Human Protein Kinase, Interferon-Inducible Double Stranded Rna Dependent ActivatorPDIA6 antibody
PDIA6 antibody was raised using the N terminal of PDIA6 corresponding to a region with amino acids KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSDegré de pureté :Min. 95%SERPINA3 antibody
SERPINA3 antibody was raised using the middle region of SERPINA3 corresponding to a region with amino acids FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSLDegré de pureté :Min. 95%SETD7 antibody
The SETD7 antibody is a monoclonal antibody that specifically targets SETD7, an enzyme involved in various cellular processes. This antibody has been shown to react with levothyroxine and interleukin-6, indicating its potential role in modulating thyroid hormone levels and immune responses. Additionally, the SETD7 antibody has demonstrated reactivity towards basic proteins such as collagen, suggesting its involvement in extracellular matrix remodeling. Furthermore, this monoclonal antibody may have implications in cholinergic signaling due to its reactivity with acetylcholine and acetyltransferase. Overall, the SETD7 antibody shows promise as a versatile tool for studying protein function and exploring potential therapeutic applications.eIF5A2 antibody
eIF5A2 antibody was raised in rabbit using residues 108-122 [VREDLKLPEGELGKE] of the 17 kDa human, mouse and rat EIF5A2 protein as the immunogen.Degré de pureté :Min. 95%Estrogen Receptor alpha antibody
The Estrogen Receptor alpha antibody is a highly specialized serine protease that is commonly used in Life Sciences. This antibody is colloidal in nature and belongs to the class of Polyclonal Antibodies. It has been specifically designed to target the estrogen receptor alpha, which plays a crucial role in various biological processes.Goat anti Monkey IgM (rhodamine)
Goat anti-monkey IgM (Rhodamine) was raised in goat using monkey IgM mu chain as the immunogen.Degré de pureté :Min. 95%ALPP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALPP antibody, catalog no. 70R-1570
Degré de pureté :Min. 95%alpha 2 Antiplasmin antibody (HRP)
alpha 2 Antiplasmin antibody (HRP) was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.POLL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POLL antibody, catalog no. 70R-5637
Degré de pureté :Min. 95%TRAF1 antibody
The TRAF1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets the tumor necrosis factor receptor-associated factor 1 (TRAF1), which plays a crucial role in various cellular processes, including insulin and epidermal growth factor signaling pathways. This antibody can be used for research purposes to study the function and regulation of TRAF1.OXCT2 antibody
OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
Degré de pureté :Min. 95%DSCR1 isoform b protein
1-117 amino acids: MKLYFAQTLH IGSSHLAPPN PDKQFLISPP ASPPVGWKQV EDATPVINYD LLYAISKLGP GEKYELHAAT DTTPSVVVHV CESDQEKEEE EEMERMRRPK PKIIQTRRPE YTPIHLS
Degré de pureté :Min. 95%NIP7 protein (His tag)
1-180 amino acids: MRPLTEEETR VMFEKIAKYI GENLQLLVDR PDGTYCFRLH NDRVYYVSEK IMKLAANISG DKLVSLGTCFGKFTKTHKFR LHVTALDYLA PYAKYKVWIK PGAEQSFLYG NHVLKSGLGR ITENTSQYQG VVVYSMADIPLGFGVAAKST QDCRKVDPMA IVVFHQADIG EYVRHEETLT LEHHHHHHDegré de pureté :Min. 95%Goat anti Human IgG (Alk Phos)
Goat anti-Human IgG (Alk Phos) was raised in goat using purified Human IgG, as the immunogen.Degré de pureté :Min. 95%Smad2 antibody
The Smad2 antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically target and bind to activated Smad2, a key protein involved in cardiomyocyte function. This antibody can be used in various research applications, including the study of cardiac development, signaling pathways, and disease mechanisms.HNRPA1 protein (His tag)
Purified recombinant Human HNRPA1 protein (His tag)Degré de pureté :Min. 95%ZNF491 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF491 antibody, catalog no. 70R-8423Degré de pureté :Min. 95%HSP27 antibody
The HSP27 antibody is a highly specialized product used in the field of life sciences. It is an activated growth factor that plays a crucial role in various cellular processes. This antibody specifically targets HSP27, a protein involved in the regulation of cell growth and survival.
USP33 antibody
USP33 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%ALK antibody
The ALK antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ALK protein, which is involved in cell growth and division. The ALK antibody can be used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. It has been shown to effectively detect ALK-positive cells and can be used to study the role of ALK in cancer development and progression. In addition, the ALK antibody can be conjugated with different labels or enzymes for specific detection purposes. With its high specificity and sensitivity, the ALK antibody is a valuable tool for researchers studying growth factors, inhibitors, and other proteins involved in cellular processes.CD4 antibody
The CD4 antibody is a glycoprotein that plays a crucial role in the immune system. It is involved in the activation of T cells and helps regulate their response to antigens. The CD4 antibody can be used as a tool for research purposes, such as identifying specific cell types or studying immune responses.APC antibody
APC protein antibody was raised in Rat using GST fusion protein having the APC region A as the immunogen.Factor IX protein
Factor IX protein is a crucial component of the blood clotting cascade. It is a glycoprotein that plays a vital role in the formation of blood clots to prevent excessive bleeding. Factor IX protein is used as a therapeutic treatment for individuals with hemophilia B, a genetic disorder characterized by the absence or dysfunction of this clotting factor.Degré de pureté :Min. 95%UBE2D1 antibody
UBE2D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREDonkey anti Guinea Pig IgG (H + L) (biotin)
Donkey anti-guinea pig IgG (H + L) (biotin) was raised in donkey using guinea pig IgG (H & L) as the immunogen.SLC34A3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC34A3 antibody, catalog no. 70R-7902Degré de pureté :Min. 95%TPTE Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TPTE antibody, catalog no. 70R-1630Degré de pureté :Min. 95%Connexin 43 antibody
The Connexin 43 antibody is a glycoprotein that plays a crucial role in various biological processes. It is commonly used in research and clinical settings to study thrombotic thrombocytopenic purpura, microvessel density, and spleen ferritin levels. This polyclonal antibody specifically targets Connexin 43, which is an important protein involved in cell communication and growth regulation.Degré de pureté :Min. 95%TMEM161B antibody
TMEM161B antibody was raised using the N terminal of TMEM161B corresponding to a region with amino acids ESKPLTIPKDIDLHLETKSVTEVDTLALHYFPEYQWLVDFTVAATVVYLVDegré de pureté :Min. 95%TSTA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSTA3 antibody, catalog no. 70R-6048Degré de pureté :Min. 95%IFIT5 antibody
IFIT5 antibody was raised using the N terminal of IFIT5 corresponding to a region with amino acids LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKADegré de pureté :Min. 95%Fibronectin antibody
The Fibronectin antibody is a highly specialized product in the field of Life Sciences. It is an electrode that specifically targets acidic environments and is designed to detect and bind to fibronectin, a glycoprotein found in collagen. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting fibronectin in various biological samples.HSF1 antibody
The HSF1 antibody is a highly specialized antibody that targets the heat shock factor 1 (HSF1) protein. This protein plays a crucial role in cellular stress response and regulation of gene expression. The HSF1 antibody is designed to specifically bind to HSF1, neutralizing its activity and preventing it from activating stress response genes.Degré de pureté :Min. 95%MDM2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.Degré de pureté :Min. 95%Goat anti Human IgA (alpha chain) (rhodamine)
This antibody reacts with heavy chains on human IgE (epsilon chain).Degré de pureté :Min. 95%ASGR2 antibody
ASGR2 antibody was raised using the N terminal of ASGR2 corresponding to a region with amino acids STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVα Actinin 4 antibody
alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIZNF317 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF317 antibody, catalog no. 70R-8356Degré de pureté :Min. 95%Keratin K7 antibody
Keratin K7 antibody was raised in Guinea Pig using synthetic peptide (C-SAGPGLLKAYSIRT) of human keratin K7 coupled to KLH as the immunogen.Degré de pureté :Min. 95%PDXK antibody
PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN
