Produits biochimiques et réactifs

ERP44 antibody was raised in Rabbit using Human ERP44 as the immunogen

Mouse monoclonal AKR1A1 antibody

Rabbit polyclonal EGFR antibody (Ser1070)

Purified recombinant Dengue NS1 protein (N-terminal) (GST tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of BCHE antibody, catalog no. 70R-1889

CLEC4M antibody was raised using the N terminal of CLEC4M corresponding to a region with amino acids LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV

EIF3E antibody was raised using the N terminal of EIF3E corresponding to a region with amino acids ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ

Mouse monoclonal TBCEL antibody

Rabbit Polyclonal CST2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CLCNKB antibody, catalog no. 70R-5058

Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase crucial for regulating key cellular functions, including growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt/mTOR pathway, which integrates external signals to maintain cellular function and adaptation. Humans express three Akt isoforms—Akt1, Akt2, and Akt3—each encoded by a distinct gene. The activation of Akt generally starts when external signals like growth factors or insulin bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane, which attracts Akt to the membrane, where it undergoes phosphorylation at two specific sites, Thr308 and Ser473, to become fully active. Once activated, Akt moves through the cell to phosphorylate target proteins involved in various cellular pathways.The primary functions of Akt include promoting cell survival by inhibiting apoptosis through the inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also supports cell growth and proliferation by activating mTOR, a central regulator of protein synthesis, while suppressing growth-arrest pathways. Akt plays a key role in metabolic regulation by increasing glucose uptake and glycolysis, largely through GLUT4 translocation and hexokinase activation, which is particularly important in muscle and fat tissues. It contributes to angiogenesis by upregulating VEGF expression, aiding tissue growth and repair, and it promotes cell migration, facilitating wound healing as well as the spread of cancer cells in malignancy. Due to its broad role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor growth, which makes the PI3K/Akt/mTOR pathway a target for many cancer therapies. Additionally, Akt's role in glucose metabolism links it to insulin signaling, where defects can impair glucose uptake, leading to insulin resistance and type 2 diabetes.

CDK5RAP3 antibody was raised in Rabbit using Human CDK5RAP3 as the immunogen

The TRPM2 antibody is a highly specialized polyclonal antibody that targets the insulin receptor. This antibody is widely used in Life Sciences research to study glucose metabolism and its regulation. It specifically recognizes the activated form of glucose-6-phosphate, a key molecule in insulin signaling pathways.

ZNF668 antibody was raised in rabbit using the C terminal of ZNF668 as the immunogen

MAP2K3 antibody was raised using the C terminal of MAP2K3 corresponding to a region with amino acids EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKK

KIAA0513 antibody was raised in Rabbit using Human KIAA0513 as the immunogen

This peptide represents a metabolite of Icatibant acetate (Firazyr). The Icatibant peptide is a selective and competitive bradykinin B2 receptor antagonist, with strong affinity for the B2 receptor.Bradykinin receptor B2 is a G-protein coupled receptor for bradykinin which is ubiquitously and constitutively expressed in healthy tissues. Bradykinin receptor B2 stimulates the mitogen-activated protein kinase (MAPK) pathway and stimulates phospholipase C to increase intracellular free calcium. The B2 receptor also forms a complex with angiotensin converting enzyme (ACE), and this is thought to play a role in cross-talk between the renin-angiotensin system (RAS) and the kinin-kallikrein system (KKS). The bradykinin peptide elicits many responses including: vasodilation, oedema, smooth muscle spasm, pain fibre stimulation and microglia and T cells migration.The serine residue at position 1 of this peptide is isotopically labelled with carbon-13 (3) and nitrogen-15 (1), giving this peptide a mass increase of 4 compared to the unlabelled peptide. Tic refers to 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid and Oic is octahydroindole-2-carboxylic acid.

A synthetic peptide for use as a blocking control in assays to test for specificity of DCP1B antibody, catalog no. 70R-8999

FZD6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE