Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.014 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.371 produits)
130589 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Glutamate Pyruvate Transaminase protein (Porcine)
Purified native Porcine Glutamate Pyruvate Transaminase protein
Degré de pureté :Min. 95%FLI1 antibody
The FLI1 antibody is a highly specialized antibody that is designed to target and bind to the FLI1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting activated FLI1 in human serum samples.Hspb7 antibody
Hspb7 antibody was raised in rabbit using the middle region of Hspb7 as the immunogenDegré de pureté :Min. 95%Beta Lactamase Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LACTB antibody, catalog no. 70R-2442Degré de pureté :Min. 95%alpha Synuclein A53T protein
MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVTTVAEKTK EQVTNVGGAV VTGVTAVAQK TVEGAGSIAA ATGFVKKDQL GKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEADegré de pureté :Min. 95%EBI3 antibody
EBI3 antibody was raised using the middle region of EBI3 corresponding to a region with amino acids TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPSLC4A2 antibody
SLC4A2 antibody was raised using the N terminal of SLC4A2 corresponding to a region with amino acids MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEIDegré de pureté :Min. 95%C4BPB antibody
C4BPB antibody was raised using the N terminal of C4BPB corresponding to a region with amino acids CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV
Degré de pureté :Min. 95%RBMS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBMS1 antibody, catalog no. 70R-1624Degré de pureté :Min. 95%PDE7B antibody
PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%RBP4 antibody
RBP4 antibody was raised in mouse using recombinant human RBP4 (19-201aa) purified from E. coli as the immunogen.BID antibody
BID antibody was raised in mouse using recombinant human BID (1-195aa) purified from E. coli as the immunogen.TNF alpha antibody
TNF alpha antibody is a specific antibody that targets tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. This antibody is widely used in Life Sciences research to study the role of TNF-α in various biological processes. It can be used for applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry.Fgf1 antibody
Fgf1 antibody was raised in rabbit using the N terminal of Fgf1 as the immunogenDegré de pureté :Min. 95%p16 antibody
The p16 antibody is a diagnostic reagent in the field of Life Sciences. It is an antibody that specifically targets and binds to p16, a protein involved in cell cycle regulation. The p16 antibody is commonly used in research and clinical settings for the detection and analysis of p16 expression levels.CYP4A1 + CYP4A2 + CYP4A3 antibody
CYP4A1/CYP4A2/CYP4A3 antibody was raised in rabbit using a synthetic peptide as the immunogen.Degré de pureté :Min. 95%SMARCA2 antibody
SMARCA2 antibody was raised in rabbit using the middle region of SMARCA2 as the immunogenADAM19 antibody
ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGDegré de pureté :Min. 95%Bax antibody
The Bax antibody is a highly effective monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and inhibit the pro-angiogenic activity of Bax, a protein that plays a crucial role in angiogenesis. This antibody has been extensively tested and validated using polymerase chain techniques, demonstrating its high specificity and potency.DCX antibody
The DCX antibody is a highly specialized monoclonal antibody that targets CD33, a protein expressed on the surface of certain cells. This antibody has been extensively studied and has shown promising results in various applications.
GANP antibody
The GANP antibody is a highly specific monoclonal antibody that is used in various assays to detect and quantify the presence of GANP (glycosylation-associated nuclear protein) in samples. It specifically recognizes the tyrosine phosphorylated form of GANP, which is activated under certain conditions. This antibody has been extensively validated and has shown high sensitivity and specificity in detecting GANP in nuclear extracts from various cell types.
Hydrocodone antibody
The Hydrocodone antibody is a monoclonal antibody that specifically targets and binds to glial fibrillary acidic protein (GFAP), an important marker for astrocytes. It has been shown to inhibit the hydroxylase activity of GFAP, which plays a key role in cholinergic neurotransmission. This antibody is widely used in Life Sciences research to study the function and regulation of astrocytes in various physiological and pathological conditions.Degré de pureté :Min. 95%beta Tubulin antibody
beta Tubulin antibody was raised in mouse using recombinant human beta-Tubulin (1-445aa) purified from E. coli as the immunogen.RAD17 antibody
The RAD17 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. It has been shown to interact with epidermal growth factor (EGF) and TGF-beta, neutralizing their effects on cell proliferation and differentiation. This monoclonal antibody specifically targets the activated form of RAD17, inhibiting its interaction with β-catenin and other proteins involved in cell signaling pathways. The RAD17 antibody is widely used in Life Sciences research to study the function of this important cell antigen. Additionally, it has been shown to have potential therapeutic applications in diseases related to abnormal cell growth, such as cancer and adipose tissue disorders. With its high specificity and potency, the RAD17 antibody is an invaluable tool for researchers looking to gain deeper insights into cellular processes and develop innovative treatments.VPS37A antibody
VPS37A antibody was raised using a synthetic peptide corresponding to a region with amino acids SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEACE antibody
ACE antibody was raised in mouse using ACE (denatured) from human kidney as the immunogen.
Pxmp3 antibody
Pxmp3 antibody was raised in rabbit using the N terminal of Pxmp3 as the immunogenDegré de pureté :Min. 95%CD28 antibody
The CD28 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It specifically targets activated CD28, a protein found on the surface of immune cells. This antibody has been extensively studied and has shown promising results in various applications.ZAP70 antibody
The ZAP70 antibody is a powerful staining reagent that is widely used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and has been extensively studied for its role in ferroptosis, a form of regulated cell death. This antibody specifically targets ZAP70, a protein involved in signal transduction pathways in immune cells.GLT8D1 antibody
GLT8D1 antibody was raised using the middle region of GLT8D1 corresponding to a region with amino acids LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWGDegré de pureté :Min. 95%ST3GAL6 antibody
The ST3GAL6 antibody is a powerful tool in the field of Life Sciences. It specifically targets the glycation of carbonic and fibrinogen, making it an ideal neutralizing agent for these molecules. This monoclonal antibody has been extensively tested and proven to effectively bind to virus surface antigens, inhibiting their activation and replication. Additionally, the ST3GAL6 antibody has shown anticoagulant properties, making it a valuable tool in preventing blood clotting disorders. Its specificity and efficacy have been confirmed using mass spectrometric methods, ensuring accurate and reliable results. Whether you are conducting research or developing therapeutics, the ST3GAL6 antibody is an essential component in your toolkit.ANXA1 antibody
The ANXA1 antibody is a highly effective inhibitor used in Life Sciences research. It is a monoclonal antibody that specifically targets and neutralizes the circovirus, preventing its replication and spread. Additionally, this antibody has been shown to inhibit the activity of epidermal growth factor, which is involved in cell proliferation and differentiation. Furthermore, the ANXA1 antibody exhibits cytotoxic properties, causing cell death in certain cancer cells. This protein also plays a role in amyloid plaque formation, making it an important target for Alzheimer's disease research. The ANXA1 antibody can be used to detect and quantify the presence of mycoplasma genitalium, a common sexually transmitted infection. Moreover, autoantibodies against annexin have been found to be associated with autoimmune disorders such as lupus and rheumatoid arthritis. Lastly, this antibody has been shown to prevent hemolysis (the destruction of red blood cells) induced by certain growth factors.NGAL antibody
The NGAL antibody is a monoclonal antibody that specifically targets and neutralizes the protein isoforms of neutrophil gelatinase-associated lipocalin (NGAL). NGAL is a biomarker that is present in human serum and has been associated with various diseases and conditions, including kidney injury, inflammation, and cancer. This antibody can be used in Life Sciences research to study the role of NGAL in different physiological and pathological processes.PDK4 antibody
PDK4 antibody was raised using the N terminal of PDK4 corresponding to a region with amino acids MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACEGAS1 antibody
The GAS1 antibody is a highly specialized monoclonal antibody that targets the phosphatase activated cytotoxic protein GAS1. This antibody has been extensively studied and proven to be effective in various research applications. It can be used for immunohistochemistry, western blotting, flow cytometry, and other techniques.NCT-504
CAS :NCT-504 is a peptide that has been shown to activate potassium channels. It binds to the receptor site and activates ion channels, including those for potassium, sodium, and calcium ions. NCT-504 is an inhibitor of ligand-gated ion channels, which are responsible for the transmission of nerve impulses. NCT-504 has been shown to inhibit GABA-A receptor channels in rat brain tissue. This drug also inhibits the binding of antibodies to tumor cells.Formule :C15H12N6O2S3Degré de pureté :Min. 95%Masse moléculaire :404.5 g/molCRP antibody
The CRP antibody is a monoclonal antibody that specifically targets pancreatic glucagon and glucagon-like peptide-1 (GLP-1). It is widely used in life sciences research and assays to detect and measure the levels of these hormones. The CRP antibody has high affinity and specificity for its target, allowing for accurate and reliable results. It can be used in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry. Additionally, the CRP antibody has been shown to have potential therapeutic uses in the treatment of diabetes and other metabolic disorders. With its ability to detect and quantify pancreatic hormones, this monoclonal antibody is an invaluable tool in both research and clinical settings.Mouse Lymphocyte antibody
Mouse lymphocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.
Degré de pureté :Min. 95%TNFSF18 antibody
TNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNDegré de pureté :Min. 95%WDR40A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDR40A antibody, catalog no. 70R-3536Degré de pureté :Min. 95%MUC1 antibody
MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMDegré de pureté :Min. 95%KLF7 antibody
The KLF7 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the pleomorphic adenoma gene 3 (PLAG3), which plays a crucial role in cell growth and proliferation. This antibody can be used to study the activation of epidermal growth factor receptor (EGFR) signaling pathways, as well as the regulation of mitogen-activated protein kinase (MAPK) signaling. The KLF7 antibody is highly specific and has been validated for use in various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is an essential tool for researchers studying neuronal development, cardiomyocyte differentiation, and other cellular processes. With its high specificity and reliability, the KLF7 antibody provides accurate and reproducible results in experiments.CCDC70 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC70 antibody, catalog no. 70R-3115Degré de pureté :Min. 95%CD138 antibody
The CD138 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the EBNA1 protein, which is involved in glycosylation and cholinergic signaling. This antibody can be used to study the function and regulation of EBNA1, as well as its interactions with other proteins and molecules. Additionally, the CD138 antibody has been shown to inhibit interferon and interleukin-6 signaling pathways, making it a valuable tool for studying immune responses and inflammation. Its high specificity and affinity make it an ideal choice for experiments requiring accurate detection of EBNA1 or related proteins. Whether you're studying autoantibodies, plasmids, or glycation processes, the CD138 antibody is an essential reagent for your research needs.
BDP1 antibody
BDP1 antibody was raised in mouse using recombinant Human B Double Prime 1, Subunit Of Rna Polymeraseiii Transcription Initiation Factor Iiib (Bdp1)Prepro-Neuropeptide Y antibody
Prepro-neuropeptide Y antibody was raised in rabbit using a synthetic Prepro-NPY 68-97 (C-PON) as the immunogen.Degré de pureté :Min. 95%TDO2 antibody
TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
OSM antibody
The OSM antibody is a highly effective monoclonal antibody that specifically targets oncostatin M (OSM), a biochemical involved in various cellular processes. This antibody has been extensively studied and proven to be highly specific and potent in inhibiting the activity of OSM. It is widely used in Life Sciences research as a valuable tool for studying the role of OSM in different biological systems.
Troponin I antibody (Dephospho) (Cardiac)
Troponin I antibody (Phospho/Cardiac) was raised in mouse using a phosphorylated form of human TnC as the immunogen.VASP antibody
The VASP antibody is a highly effective monoclonal antibody that acts as an antibiotic and growth factor in various biological processes. It specifically targets the vasodilator-stimulated phosphatase (VASP), which plays a crucial role in regulating actin dynamics and cell migration. This antibody can be used for both research and diagnostic purposes, providing valuable insights into cellular signaling pathways and protein interactions.FAM70A antibody
FAM70A antibody was raised using the N terminal of FAM70A corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMRDegré de pureté :Min. 95%PLK2 antibody
The PLK2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to activated PLK2, a protein involved in various cellular processes. This antibody can be immobilized on an electrode for use in assays and experiments. It has been shown to have cytotoxic effects, leading to the lysis of cells when exposed to human serum. Additionally, the PLK2 antibody has antiangiogenic properties, neutralizing the activity of growth factors involved in blood vessel formation. With its high specificity and potency, this antibody is a valuable tool for studying PLK2 and its role in cellular signaling pathways.ROS antibody
The ROS antibody is a highly specialized monoclonal antibody that targets reactive oxygen species (ROS) in the body. It is commonly used in life sciences research to study the effects of ROS on various cellular processes. This antibody specifically binds to ROS, neutralizing their harmful effects and preventing oxidative damage to cells. It has been shown to inhibit the activation of TGF-beta, a key signaling molecule involved in cell growth and differentiation. Additionally, the ROS antibody can be used in combination with other antibodies such as phalloidin to visualize actin filaments and collagen in tissues. This versatile antibody is widely used in research laboratories and is an essential tool for studying oxidative stress and its impact on human health.RNF186 antibody
RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCPDegré de pureté :Min. 95%Epiandrosterone antibody
The Epiandrosterone antibody is a highly specialized biomolecule used in ophthalmic formulations. It is an antibody that specifically targets and binds to epiandrosterone, a hormone involved in various physiological processes. This monoclonal antibody has been extensively studied and proven to have high affinity and specificity for epiandrosterone.Degré de pureté :Min. 95%GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQPDegré de pureté :Min. 95%NUP98 antibody
NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGFDegré de pureté :Min. 95%GSK3beta antibody
GSK3beta antibody was raised using the C terminal of GSK3B corresponding to a region with amino acids AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF
