Produits biochimiques et réactifs

CDC26 antibody was raised in rabbit using the C terminal of CDC26 as the immunogen

Rabbit polyclonal AGP2 antibody (HRP)

A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1B1 antibody, catalog no. 70R-1071

CD40 ligand protein is an activated protein that plays a crucial role in immune response and cell signaling. It is commonly used in research and diagnostic applications. The CD40 ligand protein has an antigen binding domain that interacts with the CD40 receptor on B cells, leading to their activation and differentiation. This protein can be used as a tool in various assays, such as chemiluminescent immunoassays or DNA vaccines. It can also be conjugated to other molecules, such as monoclonal antibodies or chemokines, for specific applications. The CD40 ligand protein is stable and can be easily immobilized on surfaces like carbon electrodes for electrode-based assays. Its structure consists of amino acid residues that are methylated, providing stability and enhancing its functionality. Researchers in the life sciences field often rely on this protein to investigate immune responses and develop new therapeutic strategies.

Fenquinotrione is an anticancer drug that belongs to the class of inhibitors known as protein kinase inhibitors. It is a Chinese medicinal analog that has been shown to inhibit tumor growth by inducing apoptosis in cancer cells. Fenquinotrione acts as an inhibitor of kinases, which are enzymes involved in cell signaling and regulation. This drug has been found to be effective against various types of cancer, including lung, breast, and colon cancer. Fenquinotrione inhibits the activity of certain kinases involved in cancer cell proliferation and survival. It also blocks the formation of new blood vessels that supply nutrients to tumors, thereby preventing their growth. Fenquinotrione is excreted primarily through urine and has a favorable safety profile with minimal side effects.

The TXNDC5 antibody is a highly specific antibody that targets the antigen transthyretin. It is available in both polyclonal and monoclonal forms. This antibody is widely used in Life Sciences research for various applications, including the detection and quantification of transthyretin levels in biological samples. The TXNDC5 antibody has been shown to be activated by interleukin-6 and natriuretic peptides, making it an important tool for studying their signaling pathways. Additionally, this antibody has been used to investigate the role of TXNDC5 in antiestrogen resistance and nuclear processes. With its high specificity and sensitivity, the TXNDC5 antibody is a valuable tool for researchers working with nuclear extracts and studying the viscosity of biological samples. Choose this antibody for reliable results and accurate analysis in your experiments.

The IL1 beta antibody is a monoclonal antibody that specifically targets and binds to IL1 beta, an inflammatory cytokine involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent. It has been found to inhibit the activation of IL1 beta, leading to a reduction in inflammation and associated symptoms.

ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R8 antibody, catalog no. 70R-4732

LEC antibody was raised in mouse using highly pure recombinant human LEC as the immunogen.

Mouse monoclonal GSTA4 antibody

The ApoER2 antibody is a highly specific reagent used in Life Sciences research. It is produced by a hybridoma cell line and targets the ApoER2 molecule. This monoclonal antibody has been extensively tested and validated for its reactivity against dopamine, endogenous protein kinase, inhibitor p21, IL-2 receptor, and other relevant targets.

Purified Polyclonal Delta Opioid Receptor antibody