Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.563 produits)
- Par Biological Target(101.024 produits)
- Par usage/effets pharmacologiques(6.952 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130609 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
USP2 antibody
USP2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%CDK4 antibody
The CDK4 antibody is a monoclonal antibody that specifically targets CDK4, a protein involved in cell cycle regulation. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.USP3 antibody
USP3 antibody was raised in rabbit using the middle region of USP3 as the immunogenDegré de pureté :Min. 95%MM 54
CAS :MM 54 is a basic protein that is found in atherosclerotic lesions. MM 54 has been shown to be an acute phase protein and is released from the liver during inflammation. This protein has been shown to have diagnostic potential for cardiovascular diseases, as it has been shown to be elevated in patients with atherosclerotic lesions. The expression of MM 54 in muscle tissue is also associated with inflammatory processes, such as TNF-α, which are linked to cardiovascular disease.Formule :C70H121N29O15S4Degré de pureté :Min. 95%Masse moléculaire :1,737.2 g/molAp3b1 antibody
Ap3b1 antibody was raised in rabbit using the N terminal of Ap3b1 as the immunogenDegré de pureté :Min. 95%AKR1C3 protein (His tag)
1-323 amino acids: MGSSHHHHHH SSGLVPRGSH MDSKHQCVKL NDGHFMPVLG FGTYAPPEVP RSKALEVTKL AIEAGFRHID SAHLYNNEEQ VGLAIRSKIA DGSVKREDIF YTSKLWSTFH RPELVRPALE NSLKKAQLDY VDLYLIHSPM SLKPGEELSP TDENGKVIFD IVDLCTTWEA MEKCKDAGLA KSIGVSNFNR RQLEMILNKP GLKYKPVCNQ VECHPYFNRS KLLDFCKSKD IVLVAYSALG SQRDKRWVDP NSPVLLEDPV LCALAKKHKR TPALIALRYQ LQRGVVVLAK SYNEQRIRQN VQVFEFQLTA EDMKAIDGLD RNLHYFNSDS FASHPNYPYS DEYDegré de pureté :Min. 95%MAPK1 antibody
MAPK1 antibody was raised in mouse using recombinant human MAPK1 (1-360) purified from E.coli as the immunogen.LDHC antibody
LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV
MGB antibody
The MGB antibody is a medicament that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to TGF-beta, a growth factor involved in various physiological processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of TGF-beta.
Elastase protein
The elastase protein is a highly versatile and essential component in the field of Life Sciences. It is widely used in various applications, including streptavidin-based assays, hybridization studies, and target molecule detection. This protein has been extensively studied for its role in diseases such as cryptosporidium infection.Degré de pureté :Min. 95%NANP antibody
The NANP antibody is a monoclonal antibody that targets myostatin, a protein involved in muscle growth regulation. This antibody specifically binds to myostatin and inhibits its activity, leading to increased muscle mass and strength. In addition to its effects on myostatin, the NANP antibody has been shown to interact with other proteins such as elastase and lipoprotein lipase. These interactions may have implications for various biological processes, including fibrinogen metabolism and lipid metabolism. The NANP antibody is widely used in life sciences research and has applications in areas such as drug discovery, diagnostics, and therapeutics. Its specificity and high affinity make it a valuable tool for studying the role of myostatin in muscle development and disease.
SFN antibody
SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTDegré de pureté :Min. 95%TMEM127 antibody
TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ
Degré de pureté :Min. 95%RHOB antibody
The RHOB antibody is a monoclonal antibody specifically designed to target and bind to the fibroin protein. It belongs to the class of anti-CD20 antibodies and is widely used in Life Sciences research. This antibody has been extensively tested and validated for its high specificity and affinity towards its target.LIX1L antibody
LIX1L antibody was raised using a synthetic peptide corresponding to a region with amino acids METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAMEF2D antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, hindering transcription and replication. Extensive research has demonstrated its high efficacy through patch-clamp techniques on human erythrocytes. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.CHRNA7 antibody
The CHRNA7 antibody is a highly specialized antibody that targets the CHRNA7 protein, which is involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in research applications.SERPINB13 antibody
SERPINB13 antibody was raised in rabbit using residues 310-324 [SEHKADYSGMSSGSG] of the human SERPINB13 protein as the immunogen.Degré de pureté :Min. 95%SDS antibody
The SDS antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to SDS (sodium dodecyl sulfate), a commonly used solute in various laboratory techniques. This antibody has been extensively tested and proven to be highly specific and sensitive for the detection of SDS.GIMAP5 antibody
GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLDegré de pureté :Min. 95%GFP Tag antibody
The GFP Tag antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the green fluorescent protein (GFP) tag, which is commonly used as a marker in molecular biology experiments.
LRP1 antibody
LRP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
4EBP1 antibody
The 4EBP1 antibody is a polyclonal antibody used to detect the presence of 4EBP1 protein. It is produced by immunizing animals with a synthetic peptide corresponding to residues near the carboxy terminus of human 4EBP1 protein. This antibody recognizes both native and recombinant forms of 4EBP1 protein and can be used in various immunoassays, including ELISA, Western blotting, and immunoprecipitation. The 4EBP1 antibody has been used to study the role of this protein in estradiol-induced gonadotropin release from rat pituitary cells and c-myc expression in human chorionic gonadotropin-treated cells. It has also been used to detect serum albumin after methamphetamine administration.CD88 antibody
The CD88 antibody is a monoclonal antibody that targets the CD88 glycoprotein. This antibody has been shown to inhibit the growth factor androgen, which is found in human serum. It is commonly used in immunoassays and as a research tool for studying protein kinase inhibitors. The CD88 antibody has also been used to detect autoantibodies and as an electrode in various applications. With its anti-angiogenesis properties, this antibody shows great potential in therapeutic interventions. Whether you need it for research or diagnostic purposes, the CD88 antibody is a reliable tool that delivers accurate and consistent results.ATE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATE1 antibody, catalog no. 70R-2257Degré de pureté :Min. 95%HSP60 antibody
The HSP60 antibody is a monoclonal antibody that specifically targets heat shock protein 60 (HSP60). This protein is involved in various cellular processes, including protein folding and transport. The HSP60 antibody has been shown to bind to HSP60 in human serum, inhibiting its function and preventing its interaction with other molecules such as fibronectin and TGF-beta. This antibody has also demonstrated cytotoxic effects on cancer cells, making it a potential therapeutic option for cancer treatment. Additionally, the HSP60 antibody can be used in research and diagnostic applications to detect the presence of HSP60 in samples. Its specificity and high affinity make it a valuable tool in the field of life sciences.
IL2 antibody
IL2 antibody was raised in rabbit using highly pure recombinant rat IL-2 as the immunogen.
Degré de pureté :Min. 95%Cytokeratin 16 antibody
Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKNTheophylline antibody
Theophylline antibody was raised in mouse using theophylline-3-BSA as the immunogen.Degré de pureté :>95% By Sds-Page.CLEC6A antibody
CLEC6A antibody was raised using the N terminal of CLEC6A corresponding to a region with amino acids FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKDegré de pureté :Min. 95%CD27 antibody
The CD27 antibody is a monoclonal antibody that targets the CD27 protein, which is found on the surface of certain cells in the immune system. This antibody has been shown to have a high affinity for fibronectin and can be used in research and clinical settings to study the role of CD27 in various biological processes. The CD27 antibody can also be used as a tool for detecting and quantifying levels of CD27 in samples. Additionally, this antibody has been used in combination with other antibodies, such as anti-HER2 antibodies, to enhance their therapeutic effects. Overall, the CD27 antibody is a valuable tool for researchers and clinicians working in the field of life sciences.VEGFR2 antibody
The VEGFR2 antibody is a highly specific monoclonal antibody that targets the vascular endothelial growth factor receptor 2 (VEGFR2). This receptor plays a crucial role in angiogenesis, which is the process of forming new blood vessels. By binding to VEGFR2, this antibody inhibits the interaction between VEGF and its receptor, thereby preventing the activation of downstream signaling pathways involved in cell proliferation and migration.Amphetamine antibody
Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.cAMP antibody
cAMP antibody was raised in Mouse using synthetic peptide of cAMP, conjugated to KLH as the immunogen.NAT2 antibody
NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTDegré de pureté :Min. 95%FDFT1 antibody
The FDFT1 antibody is a highly specialized monoclonal antibody that targets the growth factor protein kinase. It specifically binds to tyrosine residues on particulate proteins, preventing their activation and interfering with cellular signaling pathways. This antibody has been shown to have potent neutralizing activity against necrosis factor-related apoptosis-inducing ligand (TRAIL), a protein involved in programmed cell death. In addition, the FDFT1 antibody has demonstrated efficacy in inhibiting the replication of influenza virus by targeting the glycosylation process required for viral entry into host cells. This antibody holds great potential in the field of life sciences and may have applications in therapeutic interventions for various diseases and conditions.ASAHL antibody
ASAHL antibody was raised using the middle region of Asahl corresponding to a region with amino acids VSWLIRATLSESENFEAAVGKLAKTPLIADVYYIVGGTSPREGVVITRNRDegré de pureté :Min. 95%EMG1 antibody
EMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLETVKVGKTYELLNCDKHKSILLKNGRDPGEARPDITHQSLLMLMDSPLDPP7 antibody
DPP7 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%SOCS3 antibody
The SOCS3 antibody is a monoclonal antibody that specifically targets and binds to the protein suppressor of cytokine signaling 3 (SOCS3). It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.Klotho antibody
Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLEDegré de pureté :Min. 95%RUNX1 antibody
The RUNX1 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. This monoclonal antibody specifically targets the histidine-rich region of the RUNX1 protein, which is essential for its function. It has been extensively studied and proven to be effective in detecting and quantifying RUNX1 autoantibodies in biological samples.
USP20 antibody
USP20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%Rat PMN antibody
Rat PMN antibody was raised in rabbit using rat polymorphonuclear leucocytes as the immunogen.Degré de pureté :Min. 95%AURKA antibody
AURKA antibody was raised in rabbit using the C terminal of AURKA as the immunogenDegré de pureté :Min. 95%MATN1 antibody
MATN1 antibody was raised in Mouse using a purified recombinant fragment of human MATN1 expressed in E. coli as the immunogen.Tenomodulin antibody
Tenomodulin antibody was raised using the middle region of TNMD corresponding to a region with amino acids QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCIDegré de pureté :Min. 95%RGS5 antibody
RGS5 antibody was raised using the middle region of RGS5 corresponding to a region with amino acids PGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIUCHL3 antibody
UCHL3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%GPR108 antibody
The GPR108 antibody is a polyclonal antibody that targets the protein kinase GPR108. This antibody has been widely used in various research fields, including neuroscience and life sciences. It has been shown to have a high affinity for amyloid plaques, which are associated with neurodegenerative diseases such as Alzheimer's disease. The GPR108 antibody can be used in bioassays to study the role of GPR108 in cell growth and development. Additionally, it can be used as an anti-idiotypic antibody to detect the presence of activated GPR108 in biological samples. This antibody is commonly used in immunoassays and intraocular research to study the signaling pathways involving phosphatases and kinases. Its specificity for beta-amyloid makes it a valuable tool for studying amyloid protein-related diseases.CD33 antibody
The CD33 antibody is a monoclonal antibody that has neutralizing properties. It specifically targets glucagon, an acidic hormone involved in regulating blood sugar levels. This antibody binds to glucagon and prevents its activity, making it useful in the field of Life Sciences for studying the role of glucagon in various physiological processes.ZDHHC18 antibody
ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIIDegré de pureté :Min. 95%HRG antibody
HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids EVLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSM
Degré de pureté :Min. 95%AKT antibody
Akt, also known as Protein Kinase B (PKB), is a key enzyme involved in regulating cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to signals like growth factors. Upon activation through specific phosphorylation events, Akt drives essential cellular functions, including promoting cell survival, stimulating protein synthesis via mTOR, regulating glucose uptake, and facilitating blood vessel formation and cell movement. Due to its frequent hyperactivation in cancers, Akt is a significant target in cancer therapies, and its role in glucose metabolism links it to conditions like insulin resistance and type 2 diabetes.
Clenbuterol monoclonal antibody
The Clenbuterol monoclonal antibody is a highly specialized protein used in the field of Life Sciences. This antibody is specifically designed to target and bind to the a1 protein, which plays a crucial role in various biological processes. By binding to the a1 protein, this monoclonal antibody can effectively neutralize its activity and prevent it from carrying out its normal functions.Toxoplasma gondii antibody
Toxoplasma gondii antibody was raised in mouse using 30 kDa membrane protein of purified Toxoplasma gondii as the immunogen.PDGFRa antibody
The PDGFRa antibody is a monoclonal antibody that targets the platelet-derived growth factor receptor alpha (PDGFRa). This receptor plays a crucial role in cell growth and development by binding to growth factors such as epidermal growth factor (EGF) and natriuretic peptides. The PDGFRa antibody specifically recognizes the acidic amino-terminal region of the receptor, allowing for precise targeting and inhibition of its activity.ERCC1 antibody
The ERCC1 antibody is a monoclonal antibody that specifically binds to the ERCC1 protein, which is involved in DNA repair. This antibody can be used for various applications such as receptor binding studies, antigen detection, and protein-protein interaction assays. It has been shown to effectively recognize and bind to the activated form of ERCC1, making it a valuable tool for research in the field of DNA repair mechanisms. Additionally, this antibody has also demonstrated binding to other proteins such as collagen and virus surface antigens, indicating its versatility in different experimental settings. With its high specificity and affinity, the ERCC1 antibody provides researchers with a reliable tool for studying DNA repair pathways and related processes.Osteopontin antibody
The Osteopontin antibody is a highly effective polyclonal antibody used in the field of Life Sciences. It specifically targets angptl3, a growth factor involved in adipose tissue and mineralization. This antibody has both neutralizing and inhibitory effects on angptl3, making it an essential tool for studying its role in various biological processes. The Osteopontin antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options depending on their specific needs. Its high specificity and affinity ensure accurate and reliable results in experiments involving angptl3. Whether you are studying lipoprotein lipase activity or investigating immunogenic compositions, the Osteopontin antibody is an invaluable asset to your research endeavors.Penicillin V Postassium
Penicillin V Postassium (USP grade powder) chemical reference substanceDegré de pureté :Min. 95%
