Produits biochimiques et réactifs

The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.

The STAT3 antibody is a peptide antigen used in Life Sciences research. It is commonly used in studies involving the expression plasmid and antibodies. This antibody specifically targets the inhibitory factor of the cytokine family, interleukin-6, and has been shown to inhibit the activation of reactive glial fibrillary acidic cells. The STAT3 antibody can be used in various experimental techniques, such as immunohistochemistry and Western blotting. Its high specificity and affinity make it an ideal tool for researchers studying cell signaling pathways and inflammatory responses. With its wide range of applications, this polyclonal antibody is a valuable asset for any laboratory or research facility.

The Vimentin antibody is a highly effective tool for research in the field of Life Sciences. It is a monoclonal antibody that specifically targets vimentin, a type III intermediate filament protein found in various cell types. Vimentin plays a crucial role in maintaining cell structure and integrity, and it is involved in processes such as cell migration, adhesion, and signaling.

Purified recombinant LMO1 protein (His tag)

ELISA kit for the detection of Human GCSF in the research laboratory

Rabbit polyclonal RPS9 antibody (HRP)

Monkey Red Blood Cells are a valuable resource in the field of Life Sciences. These cells can be used for various applications such as studying the angiotensin-converting enzyme, neutralizing antibodies, and electrode development. Monkey Red Blood Cells are often used in research to develop monoclonal antibodies and pegylated products. They can also be used as biospecimens for the analysis of serum, plasma, and other fluids. Additionally, Monkey Red Blood Cells have been utilized in studies involving collagen, human serum, peptide agents, influenza hemagglutinin, brucella abortus, carbon quantum dots, chemokines, and growth factors. These cells offer researchers a reliable and versatile tool for their scientific investigations.

The Mad2L1 Antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the Mad2L1 protein, which plays a crucial role in cell division and growth regulation. This antibody is buffered and optimized for maximum stability and performance.

Rabbit polyclonal CNOT2 antibody (Ser101)

The GM2A antibody is a polyclonal antibody that has various applications in the field of Life Sciences. It can be used to detect and measure the levels of creatine kinase and phosphatase, which are important enzymes involved in cellular metabolism. Additionally, this antibody can be used for research involving mesenchymal stem cells, as it can help identify and characterize these cells. The GM2A antibody can also be used in electrode-based assays to study glucose-6-phosphate metabolism and collagen synthesis. In the medical field, this antibody has potential applications in diagnostics and therapeutics, particularly in the detection and treatment of diseases such as cancer. It has been shown to have binding affinity towards sorafenib, a drug used in the treatment of liver cancer. Furthermore, the GM2A antibody can be utilized to measure hepatocyte growth factor levels in human serum samples. Overall, this versatile antibody offers researchers and clinicians a valuable tool for studying various biological processes and developing innovative treatments.

Purified Rabbit polyclonal TR beta antibody (Ser142)

ELISA Kit for detection of IL17 in the research laboratory

Rabbit polyclonal RPL3 antibody

Rabbit polyclonal Paxillin antibody (Ser272)

The Lck antibody is a highly specific monoclonal antibody that targets the Lck protein, a tyrosine kinase involved in T-cell signaling. It is commonly used in research and diagnostic applications to study the role of Lck in various cellular processes. The Lck antibody recognizes a specific epitope on the Lck protein and can be used for immunoprecipitation, Western blotting, flow cytometry, and immunofluorescence experiments. This antibody has been extensively validated and shown to have high specificity and sensitivity. It is available as both a monoclonal antibody and a polyclonal antibody, allowing researchers to choose the best option for their specific needs. Whether you are studying T-cell activation, immune response, or signal transduction pathways, the Lck antibody is an essential tool for your research. Trust in its quality and reliability to advance your understanding of cellular biology.

ELISA Kit for detection of Leptin in the research laboratory

RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids  DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM

ELISA kit for the detection of Nucleosome in the research laboratory

Purified Goat IgG (Fc) FITC conjugate

Rabbit polyclonal FOS antibody (Thr232)