Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.117 produits)
- Par Biological Target(99.161 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.710 produits)
- Métabolites secondaires(14.222 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SB 202190 hydrochloride
CAS :<p>Inhibitor of p38 MAPK kinase</p>Formule :C20H15ClFN3ODegré de pureté :Min. 95%Masse moléculaire :367.8 g/molRat IgG ELISA kit
<p>ELISA Kit for detection of IgG in the research laboratory</p>Degré de pureté :Min. 95%Rat Leukotriene B4 ELISA kit
<p>ELISA Kit for detection of Leukotriene B4 in the research laboratory</p>Degré de pureté :Min. 95%Human Perforin 1 ELISA kit
<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>Degré de pureté :Min. 95%RGH-5526
CAS :<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>Formule :C16H25N5O3Degré de pureté :Min. 95%Masse moléculaire :335.4 g/molMouse IL2 ELISA kit
<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>Degré de pureté :Min. 95%PSA ELISA Kit
<p>ELISA kit for detection of PSA in the research laboratory</p>Degré de pureté :Min. 95%Pregnenolone ELISA kit
<p>ELISA kit for the detection of Pregnenolone in the research laboratory</p>Degré de pureté :Min. 95%Influenza A Calibration Kit
<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>Degré de pureté :Min. 95%Human VEGFR2 ELISA Kit
<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>Degré de pureté :Min. 95%LCP1 antibody
<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>Human Transferrin ELISA Kit
<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>Degré de pureté :Min. 95%Mouse IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Degré de pureté :Min. 95%Human Plasminogen ELISA Kit
<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Prealbumin ELISA Kit
<p>Please enquire for more information about Human Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%
