Produits biochimiques et réactifs

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.

IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity

BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.

Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.

Catalogue peptide; min. 95% purity

Methyl-d3-magnesium iodide solution, 1.0 M in diethyl ether, is a specialized organometallic reagent used extensively in synthetic chemistry. This compound is a labeled Grignard reagent, where the methyl group is fully deuterated. It is sourced through the synthesis involving the reaction of deuterated methyl iodide with magnesium in an anhydrous diethyl ether solvent.

BMY 7378 Dihydrochloride is a selective 5-HT1A receptor antagonist, which is synthetically derived for specialized research purposes. This compound is known for its ability to bind exclusively to the 5-HT1A receptor, inhibiting the action of serotonin. Its mechanism of action involves a high-affinity blockade of serotonin at this receptor site, making it a valuable tool for understanding serotonergic signaling pathways.

Amyloid beta protein is a peptide that is a major component of the amyloid plaques found in the brain of patients with Alzheimer's disease. Amyloid beta protein (Aβ) has been shown to form fibers and fibrils, which are aggregates of polymerized Aβ peptides. These fibrils can be imaged using a fluorescent dye called dansyl. The dansyl-labeled Aβ fibrils have been shown to have a morphology similar to that seen in electron micrographs of amyloid plaques. The quantum yield for luminescence was found to be 0.1% for the Aβ fibrils but only 0.001% for the monomeric form of Aβ peptides (Aβ 1-40). This suggests that the Aβ peptides are undergoing aggregation into amyloid beta protein fibrils before they can emit light as fluorescence or phosphorescence.

Catalogue peptide; min. 95% purity

Catalogue peptide; min. 95% purity