Produits biochimiques et réactifs

<p>ELISA kit for detection of Human IL10 in the research laboratory</p>

<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>

<p>ELISA kit for the detection of SSB in the research laboratory</p>

<p>ELISA kit for the detection of MCP1 in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FMOD antibody, catalog no. 70R-5310</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>

<p>Biotin labeling kit for IgG</p>

<p>ELISA Kit for detection of PPARa in the research laboratory</p>

<p>Please enquire for more information about Mouse Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Alpha 1-Microglobulin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat NGAL ELISA Kit</p>

<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>

<p>Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>

<p>ELISA kit for the detection of Alpha Fodrin in the research laboratory</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>ELISA kit for detection of Serotonin in the research laboratory</p>

<p>Horse IgM ELISA Kit</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Hamster (CHO) Annexin A5 ELISA Kit<br> <br>Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>

<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>

<p>ELISA kit for the detection of NGAL in the research laboratory</p>

<p>Thymus factor X is a protein that has been shown to inhibit proliferation of cancer cells in animal models. It has also been shown to have an inhibitory effect on the growth of mesenteric cancer cells and on human hepatitis B virus. Thymus factor X is a basic protein that stimulates apoptosis, or programmed cell death, by binding to monoclonal antibodies and triggering cellular events that lead to the breakdown of DNA. It also inhibits production of inflammatory cytokines in response to skin tests. Thymus factor X is active against infectious diseases such as tuberculosis, bacterial pneumonia, and chickenpox. The drug is currently being studied for use in treating primary sclerosing cholangitis, which is a chronic inflammatory disease of the bile ducts.<br>Thymus Factor X may be used therapeutically for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, but further research needs to be done before it can be approved for any therapeutic purposes.</p>

<p>ELISA kit for the detection of Estradiol in the research laboratory</p>

<p>ELISA kit for the detection of SSA in the research laboratory</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human Fetuin/AHSG ELISA Kit</p>

<p>Mouse Fetuin/AHSG ELISA Kit.</p>

<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>

<p>Quantify total bovine IgA in your samples.</p>

<p>Human Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Please enquire for more information about Mouse SAP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bovine IL-6 ELISA Kit</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>

<p>Cat IgA ELISA Kit</p>

<p>Rat Prealbumin (TTR) ELISA Kit</p>

<p>Rabbit IgG ELISA Kit - For the quantitative determination of total IgG in biological samples.</p>

<p>Horse SAA ELISA Kit</p>

<p>Bovine SAA ELISA Kit</p>

<p>The Monkey IgA ELISA kit is intended for the quantitative determination of total monkey IgA (new and old world) in biological samples.</p>

<p>Mouse Retinol Binding Protein ELISA Kit</p>

<p>Horse IgA ELISA Kit</p>

<p>Please enquire for more information about Human Apolipoprotein A1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>Pig Fibrinogen ELISA Kit</p>

<p>Quantify total bovine IgM in your samples.</p>

<p>Chicken Alpha 1-Acid Glycoprotein ELISA Kit</p>

<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of EPO in the research laboratory</p>

<p>Please enquire for more information about Dog IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cat IgE ELISA Kit</p>

<p>Hamster (CHO) Nidogen-1 ELISA Kit<br> <br>Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.</p>

<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSF1 antibody, catalog no. 70R-6326</p>

<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>

<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>

<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>Ready to use Dog/Canine Cystatin C ELISA Kit</p>

<p>Human Apolipoprotein H ELISA Kit</p>

<p>Rat Myoglobin ELISA Kit</p>

<p>Dog Osteopontin ELISA Kit - OPN is confined to the distal parts of a subset of nephrons. In the kidney the expression of OPN is severely upregulated during renal injury.Â</p>

<p>ELISA kit for detection of Testosterone in the research laboratory</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgM in the research laboratory</p>

<p>Please enquire for more information about Human Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>

<p>Recombinant Mouse MASP2 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA1 antibody, catalog no. 70R-8182</p>

<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>ELISA Kit for detection of IL25 in the research laboratory</p>

<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>

<p>ELISA kit for the detection of CA 199 in the research laboratory</p>

<p>ELISA Kit for detection of TARC in the research laboratory</p>

<p>ELISA kit for the detection of Prothrombin screen in the research laboratory</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>1. Activates TRPV1 receptor, which is involved in the transmission of pain signals and the release of inflammatory mediators<br>2. Binds to and activates P2X7 receptors, which are associated with cell death and inflammation<br>3. Blocks voltage-gated calcium channels, which play a role in neuronal excitability and muscle contraction<br>4. Inhibits the activity of MAP kinase phosphatases, which are involved in regulating the activation of MAP kinase <br>5. Stimulates ligand-gated ion channels such as nicotinic acetylcholine receptors (nAChRs) <br>6. Binds to GABA receptors, inhibiting the effects of GABA on neurons <br>7. Acts as an antagonist at dopamine D2 receptors <br>8. Binds to muscarinic M1/M3 receptors, inhibiting acetylcholine release <br>9. Binds to alpha-adrenergic receptors, leading to vas</p>

<p>ELISA kit for the detection of Human Bax in the research laboratory</p>

<p>Influenza A Antigen Capture ELISA for use in the research laboratory</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>ELISA kit for detection of Histamine in the research laboratory</p>

<p>ELISA Kit for detection of IL16 in the research laboratory</p>

<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>

<p>ELISA kit for the detection of Pregnenolone  in the research laboratory</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Amelubant is a synthetic compound designed for use in detailed biochemical research and therapeutic investigations. As a product derived from innovative chemical synthesis techniques, Amelubant is engineered to interact with particular biological pathways, predominantly in the field of inflammatory response modulation. Its mode of action involves specific binding to target receptors, influencing downstream signaling cascades.</p>

<p>Please enquire for more information about Fumaric acid-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Portion of Influenza M</p>

<p>This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial. Big Endothelin-1 (Human, 1-38) is part of the full lengthed 29 amino acid peptide Big Endothlin-1 which is a precursor peptide of the vasoconstrictorEndothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.<br>Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.</p>

<p>Bovine Serum Albumin (BSA) is a protein that is used in the pharmaceutical industry as a research tool and an immunological reagent. BSA can be used to bind, stabilize, and prevent denaturation of other proteins in the laboratory. It has been shown to inhibit ion channels and ligand-gated ion channels, which are important for membrane potentials. BSA is also an activator of receptor tyrosine kinases, which are involved in cell signaling pathways.</p>

<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>

<p>Rapalink-1 is a gene therapy drug that has been shown to be effective against resistant mutants of malignant brain tumors. Rapalink-1 is a protein that has been engineered to bind to mesenchymal markers and inhibit the progression of cancer cells. This protein also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 inhibits tumor growth by triggering autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 is an autophagy inducer that binds to mesenchymal markers on cancer cells and inhibits the progression of cancer cells. It also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients.</p>

<p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of &gt; 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>

<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>

<p>SR-4370 is a potent inhibitor of the histone deacetylase (HDAC) enzyme class. It has been shown to inhibit cholesterol synthesis and lipid biosynthesis in cells, as well as inhibiting cancer cell proliferation. SR-4370 also has antioxidant effects, which may be due to its ability to inhibit the activation of NF-κB and downstream mediators. In addition, this compound has been shown to have synergistic effects with other HDAC inhibitors and chemotherapy drugs. This drug is being developed for the treatment of cancers such as prostate cancer, melanoma, breast cancer, colon cancer, and head and neck cancer.</p>

<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>

<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>ELISA kit for the detection of GBM in the research laboratory</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>ELISA kit for detection of Human IL6 in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Purified recombinant LGALS1 protein (His tag)</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Recombinant Human POLR2K protein</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>

<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA kit for the detection of LH in the research laboratory</p>

<p>Melatonin BSA is an inhibitory factor that binds to proteins in the body, including tumor necrosis factor-alpha (TNF-α). It has been shown to have effects on adipose tissue and can be used as a monoclonal antibody for research purposes. Melatonin BSA also interacts with the growth hormone receptor and has anti-glial fibrillary acidic protein (GFAP) activity. This protein is commonly found in human serum and can be used in various life science applications. Melatonin BSA has activated and neutralizing properties, making it a versatile tool for studying proteins and antigens.</p>

<p>ELISA kit for the detection of Calcitonin in the research laboratory</p>

<p>Cortisol ELISA Kit for the determination of cortisol in human serum and plasma</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRPF6 antibody, catalog no. 70R-1449</p>

<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>

<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>

<p>ELISA kit for the detection of AFP in the research laboratory</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>ELISA kit for detection of IGF1 in the research laboratory</p>

<p>Please enquire for more information about Human Hemopexin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>ELISA Kit for detection of SCF in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OPTC antibody, catalog no. 70R-5283</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>ELISA kit for the detection of Cathepsin G in the research laboratory</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Catalogue peptide; min. 95% purity</p>