Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.130 produits)
- Par Biological Target(99.159 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.747 produits)
- Métabolites secondaires(14.222 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Tosedostat-d5
CAS :<p>Tosedostat-d5 is an analog of Tosedostat, an anticancer drug that inhibits the activity of a variety of kinases involved in cancer cell growth and survival. This compound has been shown to induce apoptosis in human cancer cells and has demonstrated promising results in preclinical studies. Tosedostat-d5 is labeled with five deuterium atoms, which makes it useful as a tracer for pharmacokinetic and metabolic studies. It is also used as a tool for investigating the metabolism of other drugs, such as rifampicin and astaxanthin, in Chinese hamster ovary cells. Inhibitors of tosedostat-d5 have been developed for use in cancer therapy, making this compound an important tool for research into new anticancer treatments.</p>Formule :C21H30N2O6Degré de pureté :Min. 95%Masse moléculaire :411.5 g/molHPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>Caspase 1 antibody
<p>The Caspase 1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets caspase 1, an enzyme involved in various cellular processes such as apoptosis and inflammation. This antibody specifically recognizes and binds to caspase 1, allowing for its detection and analysis.</p>Human VEGF ELISA kit
<p>ELISA Kit for detection of VEGF in the research laboratory</p>Degré de pureté :Min. 95%TTC27 antibody
<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>Degré de pureté :Min. 95%Gliadin IgA ELISA kit
<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>Degré de pureté :Min. 95%Human Calcitonin ELISA kit
<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>Degré de pureté :Min. 95%Goat anti Mouse IgM (mu chain)
<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>Degré de pureté :Min. 95%Rabbit MMP2 ELISA kit
<p>ELISA Kit for detection of MMP2 in the research laboratory</p>Degré de pureté :Min. 95%Human Fibronectin ELISA kit
<p>ELISA kit for the detection of Fibronectin in the research laboratory</p>Degré de pureté :Min. 95%KRAS Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRAS antibody, catalog no. 70R-5673</p>Degré de pureté :Min. 95%Human Cystatin C ELISA kit
<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>Degré de pureté :Min. 95%Centromere B ELISA kit
<p>ELISA kit for the detection of Centromere B in the research laboratory</p>Degré de pureté :Min. 95%Human ICAM1 ELISA kit
<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>Degré de pureté :Min. 95%Human Retinol Binding Protein ELISA Kit
<p>Please enquire for more information about Human Retinol Binding Protein ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Hemopexin ELISA Kit
<p>Please enquire for more information about Human Hemopexin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human IgA ELISA Kit
<p>Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Hamster CHO β 2-Microglobulin (B2M) ELISA Kit
<p>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Degré de pureté :Min. 95%Mouse KIM-1 ELISA Kit
<p>Please enquire for more information about Mouse KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Recombinant Human PD-ECGF
<p>Human sequence expressed in sf Insect Cells; purity >97% by SDS-PAGE and analyzed by silver stain.</p>Rat AGP ELISA Kit
<p>Please enquire for more information about Rat AGP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Affinity Purified anti-Human Ferritin Antibody
<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>Degré de pureté :Min. 95%Sheep IgG ELISA Kit
<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>Degré de pureté :Min. 95%Ferumoxytol
CAS :<p>Ferumoxytol is used in magnetic resonance imaging (MRI) to improve the quality of images. It is given intravenously and is excreted unchanged by the kidneys. Ferumoxytol has been shown to be safe and effective for diagnosing bowel disease, including Crohn's disease, ulcerative colitis, and diverticulitis. Ferumoxytol also has been shown to be useful in evaluating cardiac function before and after myocardial infarction. Ferumoxytol has a low toxicity profile with no significant adverse effects reported during clinical trials.</p>Formule :Fe3H2O4Degré de pureté :Min. 95%Masse moléculaire :233.55 g/molMouse Haptoglobin ELISA Kit
<p>Please enquire for more information about Mouse Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Chicken IgY ELISA Kit
<p>IgY, or immunoglobulin Y, is a type of antibody found in the immune systems of birds, reptiles, and amphibians. It serves a similar function to IgG in mammals. In birds, IgY is the primary antibody found in serum, egg yolk, and other bodily fluids, whereas in mammals, IgG is the predominant antibody. IgY antibodies are important for providing passive immunity to offspring through the transfer of antibodies from the mother to the egg yolk, similar to how mammals transfer antibodies through the placenta or breast milk. IgY antibodies have also been used in research and diagnostic applications due to their specificity and ability to be harvested from egg yolks.</p>Degré de pureté :Min. 95%Dog sIL2-R ELISA Kit
<p>A reliable ELISA Kit for quantifying soluble interleukin-2 receptor (sIL-2R, sIL2R, sTAC, sCD25) in dog serum/plasma samples.</p>Degré de pureté :Min. 95%Chicken IgM ELISA Kit
<p>For the quantitative determination of chicken immunoglobulin M (IgM) in biological samples.;</p>Degré de pureté :Min. 95%Human Prealbumin ELISA Kit
<p>Please enquire for more information about Human Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human B2M ELISA Kit
<p>Human Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Degré de pureté :Min. 95%Mouse SAP ELISA Kit
<p>Please enquire for more information about Mouse SAP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Degré de pureté :Min. 95%Nucleosome ELISA kit
<p>ELISA kit for the detection of Nucleosome in the research laboratory</p>Degré de pureté :Min. 95%Folic Acid protein
<p>Folic Acid protein is a versatile compound widely used in Life Sciences. It has various applications, including its role as an anti-HER2 antibody in human serum. Folic Acid protein interacts with insulin and epidermal growth factor, making it essential for cellular processes and growth regulation. Additionally, it has been found to have autoantibodies and acidic properties that contribute to its effectiveness as a growth factor. Folic Acid protein also exhibits anti-glial fibrillary acidic properties, which can be beneficial in certain medical conditions. With its unique amino group and carbonyl group composition, Folic Acid protein plays a crucial role in the development of insulins and other Recombinant Proteins & Antigens. Moreover, it has shown promising results when combined with trastuzumab, an anti-glial fibrillary antibody used in cancer treatment.</p>Degré de pureté :Min. 95%Human Leptin ELISA kit
<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>Degré de pureté :Min. 95%Human IL12 ELISA Kit (p70)
<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>Degré de pureté :Min. 95%Coagulation Factor III ELISA kit
<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>Degré de pureté :Min. 95%Human VCAM1 ELISA Kit
<p>ELISA kit for detection of VCAM1 in the research laboratory</p>Degré de pureté :Min. 95%Rat Clusterin ELISA Kit
<p>Rat Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>Degré de pureté :Min. 95%Rat IGF2 ELISA Kit
<p>ELISA kit for detection of IGF2 in the research laboratory</p>Degré de pureté :Min. 95%Human IFN β ELISA kit
<p>ELISA Kit for detection of IFNb in the research laboratory</p>Degré de pureté :Min. 95%Dysprosium(III) bromide
CAS :<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>Formule :Br3DyDegré de pureté :Min. 95%Masse moléculaire :402.21 g/molvon Willebrand Factor ELISA Kit
<p>ELISA Kit for detection of von Willebrand Factor in the research laboratory</p>Degré de pureté :Min. 95%SNIPER(ABL)-058
CAS :<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>Formule :C62H75N11O9SDegré de pureté :Min. 95%Masse moléculaire :1,150.4 g/molTiotropium bromide hydrate
CAS :<p>Tiotropium bromide is a long-acting bronchodilator that is used to relieve the symptoms of asthma and chronic obstructive pulmonary disease. It is a crystalline drug with an extended duration of action. Tiotropium bromide acts by binding to the beta2-adrenergic receptor, which prevents activation of these receptors and inhibits the release of inflammatory mediators. This drug has been shown to be effective for up to 12 months in adults with asthma who are not responsive to standard therapy. Tiotropium bromide does not interact significantly with other drugs, but should be used cautiously in patients with liver impairment or congestive heart failure due to its potential for adverse effects on these organs.</p>Formule :C19H24BrNO5S2Degré de pureté :Min. 95%Masse moléculaire :490.4 g/molANCA combi ELISA kit
<p>ELISA kit for the detection of ANCA combi in the research laboratory</p>Degré de pureté :Min. 95%Human IL10 ELISA Kit
<p>ELISA kit for detection of Human IL10 in the research laboratory</p>Degré de pureté :Min. 95%HCG ELISA kit
<p>ELISA Kit for detection of HCG in the research laboratory</p>Degré de pureté :Min. 95%Glucagon (Human, Rat, Mouse)-EIA Kit (1ea)
<p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>Degré de pureté :Min. 95%SSA ELISA kit
<p>ELISA kit for the detection of SSA in the research laboratory</p>Degré de pureté :Min. 95%Parvovirus IgG ELISA kit
<p>ELISA kit for the detection of Parvovirus IgG in the research laboratory</p>Degré de pureté :Min. 95%Mouse MCP1 ELISA kit
<p>ELISA kit for the detection of MCP1 in the research laboratory</p>Degré de pureté :Min. 95%Dog Red Blood Cells
<p>Dog Red Blood Cells (DRBC) are biospecimens that can be used in various research applications in the life sciences and veterinary fields. These cells have been extensively studied and characterized for their molecular properties. DRBC have been used in molecular docking studies to investigate interactions with specific targets, such as 3T3-L1 preadipocytes or activated nuclear extracts. DRBC can also be used in assays to measure specific molecules or enzymes. For example, they have been used to study the effects of thiocyanate on human enzymes or to develop monoclonal antibodies against certain targets. Additionally, DRBC can be utilized in polymerase chain reaction (PCR) experiments for genetic analysis. In veterinary applications, DRBC have been employed to study the cation transport mechanisms or growth hormone receptor activation in dogs. They have also been used to measure creatine kinase levels, which can indicate muscle damage. Overall, Dog Red Blood Cells are valuable resources for researchers and veterinarians seeking to understand various biological</p>Degré de pureté :Min. 95%Mouse Vasopressin ELISA kit
<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>Degré de pureté :Min. 95%Mouse Resistin ELISA kit
<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>Degré de pureté :Min. 95%Human A2M ELISA Kit
<p>Please enquire for more information about Human A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Angiostatin K13 ELISA Kit
<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>Degré de pureté :Min. 95%Phosphatidyl Serine IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%Prothrombin IgG/IgM ELISA kit
<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%SB 202190 hydrochloride
CAS :<p>Inhibitor of p38 MAPK kinase</p>Formule :C20H15ClFN3ODegré de pureté :Min. 95%Masse moléculaire :367.8 g/molRGH-5526
CAS :<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>Formule :C16H25N5O3Degré de pureté :Min. 95%Masse moléculaire :335.4 g/molToxoplasma gondii IgM ELISA kit
<p>ELISA kit for the detection of Toxoplasma gondii IgM in the research laboratory</p>Degré de pureté :Min. 95%Parietal Cell ELISA kit
<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>Degré de pureté :Min. 95%Rat PPARa ELISA kit
<p>ELISA Kit for detection of PPARa in the research laboratory</p>Degré de pureté :Min. 95%Dengue Virus IgM ELISA kit
<p>ELISA kit for the detection of Dengue Virus IgM in the research laboratory</p>Degré de pureté :Min. 95%Neurokinin A (Human, Porcine, Rat, Mouse)
<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>Formule :C50H80N14O14S•2CH3COOH•5H2ODegré de pureté :Min. 95%Masse moléculaire :1,343.48 g/molSPOPL Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPOPL antibody, catalog no. 70R-8870</p>Degré de pureté :Min. 95%Peptide YY(3-36), PYY, human
<p>Custom research peptide; min purity 95%.</p>Formule :C180H279N53O54Degré de pureté :Min. 95%Masse moléculaire :4,049.55 g/molRat Fibronectin ELISA Kit
<p>ELISA kit for detection of Fibronectin in the research laboratory</p>Degré de pureté :Min. 95%Goat anti Rabbit IgG (H + L) (biotin)
<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>Degré de pureté :Min. 95%Human C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Adrenaline/Noradrenaline ELISA Kit (2-CAT)
<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>Degré de pureté :Min. 95%Mouse Oxytocin ELISA kit
<p>ELISA Kit for detection of Oxytocin in the research laboratory</p>Degré de pureté :Min. 95%Rabbit anti Goat IgG (H + L) (Alk Phos)
<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>Degré de pureté :Min. 95%ENA ELISA kit
<p>ELISA kit for the detection of ENA in the research laboratory</p>Degré de pureté :Min. 95%Serotonin ELISA Kit
<p>ELISA kit for detection of Serotonin in the research laboratory</p>Degré de pureté :Min. 95%Dihydrotestosterone ELISA Kit
<p>ELISA kit for detection of Dihydrotestosterone in the research laboratory</p>Degré de pureté :Min. 95%Fish Prolactin ELISA kit
<p>ELISA Kit for detection of Prolactin in the research laboratory</p>Degré de pureté :Min. 95%ssDNA ELISA kit
<p>ELISA kit for the detection of ssDNA in the research laboratory</p>Degré de pureté :Min. 95%Dog CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>Degré de pureté :Min. 95%Thyroglobulin ELISA kit
<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>Degré de pureté :Min. 95%Mouse C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Monkey C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Human Haptoglobin ELISA Kit
<p>Please enquire for more information about Human Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Mouse NGAL ELISA Kit
<p>Please enquire for more information about Mouse NGAL ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Monkey Plasminogen ELISA Kit
<p>Plasminogen is a protein that plays a crucial role in the blood clotting process. It is produced by the liver and circulates in the blood. Plasminogen is inactive in its native form, but it can be converted into its active form, called plasmin, through a process known as fibrinolysis.<br>Fibrinolysis is the body's natural mechanism to dissolve blood clots. When a blood clot forms, plasminogen binds to it. Activators, such as tissue plasminogen activator (tPA), trigger the conversion of plasminogen into plasmin. Plasmin then breaks down the fibrin mesh of the blood clot, leading to its dissolution.<br>This process is important for maintaining proper blood flow and preventing excessive clot formation. Plasminogen and the fibrinolysis pathway are essential components of the body's hemostatic (blood clotting) and thrombolytic (clot dissolution) systems.</p>Degré de pureté :Min. 95%Mouse IgG2A ELISA Kit
<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Rat IgG ELISA Kit
<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat IgE ELISA Kit
<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rabbit IgG ELISA Kit
<p>Rabbit IgG ELISA Kit - For the quantitative determination of total IgG in biological samples.</p>Degré de pureté :Min. 95%Monkey IgA ELISA Kit
<p>The Monkey IgA ELISA kit is intended for the quantitative determination of total monkey IgA (new and old world) in biological samples.</p>Degré de pureté :Min. 95%Mouse IgG3 ELISA Kit
<p>Please enquire for more information about Mouse IgG3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgA ELISA Kit
<p>Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgG1 ELISA Kit
<p>Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Chicken Ovotransferrin (Conalbumin) ELISA Kit
<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>Degré de pureté :Min. 95%Mouse IgE ELISA Kit
<p>Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%CHO NUCB2 ELISA Kit
<p>Please enquire for more information about CHO NUCB2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Monkey IgM ELISA Kit
<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>Degré de pureté :Min. 95%Mouse IgM ELISA Kit
<p>Please enquire for more information about Mouse IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgG ELISA Kit
<p>Mouse IgG ELISA Kit - For the quantitative determination of total mouse IgG in biological samples that may contain bovine,horse or human proteins immunoglobulins.</p>Degré de pureté :Min. 95%Monkey IgG ELISA Kit
<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>Degré de pureté :Min. 95%Pig CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>Degré de pureté :Min. 95%Human Plasminogen ELISA Kit
<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Dog Albumin ELISA Kit
<p>For the quantitative determination of canine/dog albumin in biological samples.</p>Degré de pureté :Min. 95%Donkey anti Chicken IgY (H + L) (HRP)
<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H & L) as the immunogen.</p>ANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%Hamster CHO Matrix metalloproteinase-19 (MMP-19) ELISA Kit
<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>Degré de pureté :Min. 95%Mouse Prealbumin ELISA Kit
<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>Degré de pureté :Min. 95%Horse IgG ELISA Kit
<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>Degré de pureté :Min. 95%Rat Ferritin ELISA Kit
<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Cat IgG ELISA Kit
<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>Degré de pureté :Min. 95%Cat CRP ELISA Kit
<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>Degré de pureté :Min. 95%Dog Thymidine Kinase (TK1) ELISA Kit
<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>Degré de pureté :Min. 95%Pig IgG ELISA Kit
<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>Degré de pureté :Min. 95%Monkey Fibrinogen ELISA Kit
<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>Degré de pureté :Min. 95%Human Ferritin ELISA Kit
<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Hamster CHO Clusterin ELISA Kit
<p>Hamster (CHO) Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>Degré de pureté :Min. 95%Bovine CRP ELISA Kit
<p>Bovine/Cow CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cow/bovine samples.</p>Degré de pureté :Min. 95%Mouse Fibrinogen ELISA Kit
<p>Please enquire for more information about Mouse Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Dog SAA ELISA Kit
<p>Canine/Dog SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in dog samples.</p>Degré de pureté :Min. 95%Chicken SAA ELISA Kit
<p>Chicken SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in chicken samples.</p>Degré de pureté :Min. 95%Dog IgA ELISA Kit
<p>Please enquire for more information about Dog IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human IgE ELISA Kit
<p>Please enquire for more information about Human IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rab23 antibody
<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>Degré de pureté :Min. 95%Vamp1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Vamp1 antibody, catalog no. 70R-9794</p>Degré de pureté :Min. 95%Rat Histamine ELISA kit
<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>Degré de pureté :Min. 95%Histamine release ELISA kit
<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>Degré de pureté :Min. 95%Rubella ELISA Kit
<p>ELISA kit for detection of Rubella in the research laboratory</p>Degré de pureté :Min. 95%Jo1 ELISA kit
<p>ELISA kit for the detection of Jo1 in the research laboratory</p>Degré de pureté :Min. 95%TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>Phospholipid Screen IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%Mesotocin trifluroacetate
CAS :<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Formule :C43H66N12O12S2Degré de pureté :Min. 95%Masse moléculaire :1,007.19 g/mol05:0 PC
CAS :<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Formule :C18H36NO8PDegré de pureté :Min. 95%Masse moléculaire :425.45 g/molAmyloid beta-Protein (36-38)
CAS :<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Formule :C9H17N3O4Degré de pureté :Min. 95%Masse moléculaire :231.25 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/molCJC-1295
CAS :<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Degré de pureté :Min. 95%[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H94N20O21Masse moléculaire :1,371.48 g/molHead activator
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molProlactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H244N54O41SMasse moléculaire :3,576.01 g/molH-His-Arg-OH
CAS :<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/mol
