Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.117 produits)
- Par Biological Target(99.161 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.705 produits)
- Métabolites secondaires(14.220 produits)
130581 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Toreforant
CAS :<p>Antagonist of histamine receptor H4</p>Formule :C23H32N6Degré de pureté :Min. 95%Masse moléculaire :392.54 g/molHuman IL-6 ELISA Kit
<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>Degré de pureté :Min. 95%Mouse Leptin ELISA Kit
<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>Degré de pureté :Min. 95%Pig Haptoglobin ELISA Kit
<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit
<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%ANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%Azido-dPEG®3-Amine
CAS :<p>Azido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Degré de pureté :Min. 95%Masse moléculaire :218.25 g/molCardiolipin screen IgG/IgM/IgA1 ELISA kit
<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>Degré de pureté :Min. 95%Rat/Mouse Corticosterone ELISA kit
<p>ELISA kit for the detection of Rat/Mouse Corticosterone in the research laboratory</p>Degré de pureté :Min. 95%Neurokinin A (Human, Porcine, Rat, Mouse)
<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>Formule :C50H80N14O14S•2CH3COOH•5H2ODegré de pureté :Min. 95%Masse moléculaire :1,343.48 g/molHuman VEGF ELISA kit
<p>ELISA Kit for detection of VEGF in the research laboratory</p>Degré de pureté :Min. 95%Rat IL23 ELISA kit
<p>ELISA Kit for detection of IL23 in the research laboratory</p>Degré de pureté :Min. 95%Human TPO ELISA kit
<p>ELISA Kit for detection of TPO in the research laboratory</p>Degré de pureté :Min. 95%AFP ELISA kit
<p>ELISA kit for the detection of AFP in the research laboratory</p>Degré de pureté :Min. 95%Human RBP4 ELISA Kit
<p>ELISA kit for detection of RBP4 in the research laboratory</p>Degré de pureté :Min. 95%Annexin V ELISA kit
<p>ELISA kit for the detection of Annexin V in the research laboratory</p>Degré de pureté :Min. 95%Human Osteopontin ELISA Kit
<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>Degré de pureté :Min. 95%Human Growth Hormone ELISA Kit
<p>ELISA kit for detection of Growth Hormone in the research laboratory</p>Degré de pureté :Min. 95%Triiodothyronine ELISA Kit
<p>ELISA kit for detection of Triiodothyronine in the research laboratory</p>Degré de pureté :Min. 95%MicroAlbumin ELISA kit
<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>Degré de pureté :Min. 95%Human Hemoglobin ELISA Kit
<p>Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>Degré de pureté :Min. 95%PQR626
CAS :<p>PQR626 is a human analog of astaxanthin, a carotenoid with strong antioxidant properties. It has been shown to have anti-cancer effects by inhibiting the activity of trypsin-like proteases and kinases involved in tumor cell growth and survival. PQR626 induces apoptosis in cancer cells and has been investigated as a potential treatment for various types of cancer, including Chinese hamster ovary cells and prostate cancer. This compound also shows promise as an inhibitor of rifampicin-induced urinary excretion, which may increase the bioavailability of other drugs.</p>Formule :C20H25F2N7O2Degré de pureté :Min. 95%Masse moléculaire :433.5 g/molTSH antibody
<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>Degré de pureté :Min. 95%Human Laminin ELISA Kit
<p>ELISA kit for detection of Laminin in the research laboratory</p>Degré de pureté :Min. 95%Human A2M ELISA Kit
<p>Please enquire for more information about Human A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Degré de pureté :Min. 95%cAMP ELISA kit
<p>ELISA kit for the detection of cAMP in the research laboratory</p>Degré de pureté :Min. 95%Human Transferrin ELISA Kit
<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>Degré de pureté :Min. 95%Rat Albumin ELISA Kit
<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Complement C3a des Arg ELISA kit
<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>Degré de pureté :Min. 95%Human CX3CL1 ELISA Kit
<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>Degré de pureté :Min. 95%Human SAA ELISA Kit
<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Nucleosome ELISA kit
<p>ELISA kit for the detection of Nucleosome in the research laboratory</p>Degré de pureté :Min. 95%Neutrophil Gelatinase Associated Lipocalin/Lipocalin-2, human, recombinant
<p>Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. NGAL binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients with urinary tract infections. Additionally, NGAL has been shown to be associated with neurological diseases, such as Alzheimer's disease and Parkinson's disease. The recombinant human form of this protein can be used for research purposes or for the development of diagnostic tools. Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. It binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients</p>Degré de pureté :Min. 95%Rat Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Degré de pureté :Min. 95%Mouse Cystatin C ELISA Kit
<p>ELISA kit for detection of Cystatin C in the research laboratory</p>Degré de pureté :Min. 95%GPR37L1 antibody
<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol
CAS :<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C45H84O6Degré de pureté :Min. 95%Masse moléculaire :721.1 g/molMouse PGD2 ELISA kit
<p>ELISA Kit for detection of PGD2 in the research laboratory</p>Degré de pureté :Min. 95%CYP2A6 antibody
<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>SSA ELISA kit
<p>ELISA kit for the detection of SSA in the research laboratory</p>Degré de pureté :Min. 95%Dopamine ELISA kit
<p>ELISA kit for the detection of Dopamine in the research laboratory</p>Degré de pureté :Min. 95%VMAT2 antibody
<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>Degré de pureté :Min. 95%Mouse IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Degré de pureté :Min. 95%SEK1 antibody
<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>Degré de pureté :Min. 95%Mouse Resistin ELISA kit
<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>Degré de pureté :Min. 95%Glucagon (Human, Rat, Mouse)-EIA Kit (1ea)
<p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>Degré de pureté :Min. 95%EPO ELISA kit
<p>ELISA kit for the detection of EPO in the research laboratory</p>Degré de pureté :Min. 95%Rat PDGFAB ELISA Kit
<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>Degré de pureté :Min. 95%Mouse Laminin ELISA Kit
<p>ELISA kit for detection of Laminin in the research laboratory</p>Degré de pureté :Min. 95%Rat Free Triiodothyronine ELISA kit
<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>Degré de pureté :Min. 95%Mouse Free Triiodothyronine ELISA kit
<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>Degré de pureté :Min. 95%Dequalinium chloride hydrate
CAS :<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>Formule :C30H40N4•Cl2•(H2O)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :545.6 g/molRat NGFb ELISA Kit
<p>ELISA Kit for detection of NGFb in the research laboratory</p>Degré de pureté :Min. 95%Human OPN ELISA Kit
<p>ELISA kit for detection of OPN in the research laboratory</p>Degré de pureté :Min. 95%Mouse RANKL ELISA Kit
<p>ELISA kit for detection of Mouse RANKL in the research laboratory</p>Degré de pureté :Min. 95%Human BDNF ELISA Kit
<p>ELISA kit for detection of BDNF in the research laboratory</p>Degré de pureté :Min. 95%Rat PAI1 ELISA Kit
<p>ELISA kit for detection of Rat PAI1 in the research laboratory</p>Degré de pureté :Min. 95%Canine Prostaglandin E2 ELISA kit
<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>Degré de pureté :Min. 95%CRP ELISA kit
<p>ELISA kit for the detection of CRP in the research laboratory</p>Degré de pureté :Min. 95%1,9-Dichloro-3,7-diazanonane dihydrochloride
CAS :<p>Please enquire for more information about 1,9-Dichloro-3,7-diazanonane dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C7H18Cl4N2Degré de pureté :Min. 95%Masse moléculaire :272 g/molRheumatoid Factor IgG ELISA Kit
<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>Degré de pureté :Min. 95%Human MMP1 ELISA kit
<p>ELISA Kit for detection of MMP1 in the research laboratory</p>Degré de pureté :Min. 95%Human MMP3 ELISA Kit
<p>ELISA Kit for detection of MMP3 in the research laboratory</p>Degré de pureté :Min. 95%IgG1 κ Isotype Control Fc fusion protein (FITC)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>Degré de pureté :Min. 95%Chlamydia pneumoniae IgM ELISA kit
<p>ELISA kit for the detection of Chlamydia pneumoniae IgM in the research laboratory</p>Degré de pureté :Min. 95%Human MIF ELISA Kit
<p>ELISA kit for detection of MIF in the research laboratory</p>Degré de pureté :Min. 95%PKCβpseudosubstrate
CAS :<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>Formule :C177H294N62O38S3Degré de pureté :Min. 95%Masse moléculaire :3,995 g/molPeptide YY(3-36), PYY, human
<p>Custom research peptide; min purity 95%.</p>Formule :C180H279N53O54Degré de pureté :Min. 95%Masse moléculaire :4,049.55 g/molHuman Leptin ELISA kit
<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>Degré de pureté :Min. 95%Human IL12 ELISA Kit (p70)
<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>Degré de pureté :Min. 95%Coagulation Factor III ELISA kit
<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>Degré de pureté :Min. 95%Rabbit IL17 ELISA kit
<p>ELISA Kit for detection of IL17 in the research laboratory</p>Degré de pureté :Min. 95%Progesterone ELISA Kit
<p>ELISA kit for detection of Progesterone in the research laboratory</p>Degré de pureté :Min. 95%Mouse IGF1 ELISA Kit
<p>ELISA kit for detection of IGF1 in the research laboratory</p>Degré de pureté :Min. 95%dsDNA IgM ELISA kit
<p>ELISA kit for the detection of dsDNA IgM in the research laboratory</p>Degré de pureté :Min. 95%Human IFN β ELISA kit
<p>ELISA Kit for detection of IFNb in the research laboratory</p>Degré de pureté :Min. 95%von Willebrand Factor ELISA Kit
<p>ELISA Kit for detection of von Willebrand Factor in the research laboratory</p>Degré de pureté :Min. 95%Testosterone 3 antibody
<p>Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>Human SCF ELISA kit
<p>ELISA Kit for detection of SCF in the research laboratory</p>Degré de pureté :Min. 95%Triiodothyronine ELISA kit
<p>ELISA kit for the detection of Triiodothyronine Uptake in the research laboratory</p>Degré de pureté :Min. 95%Estradiol ELISA kit
<p>ELISA kit for the detection of Estradiol in the research laboratory</p>Degré de pureté :Min. 95%Sm1 ELISA kit
<p>ELISA kit for the detection of Sm1 in the research laboratory</p>Degré de pureté :Min. 95%SSB ELISA kit
<p>ELISA kit for the detection of SSB in the research laboratory</p>Degré de pureté :Min. 95%Mouse MCP1 ELISA kit
<p>ELISA kit for the detection of MCP1 in the research laboratory</p>Degré de pureté :Min. 95%Phosphatidyl Serine IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%Testosterone ELISA Kit
<p>ELISA kit for detection of Testosterone in the research laboratory</p>Degré de pureté :Min. 95%Human Bax ELISA kit
<p>ELISA kit for the detection of Human Bax in the research laboratory</p>Degré de pureté :Min. 95%Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>Degré de pureté :>92% By Gel Electrophoresis And Gel ScanningProthrombin IgG/IgM ELISA kit
<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%PDGFB antibody
<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>Degré de pureté :Min. 95%Fibromodulin Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FMOD antibody, catalog no. 70R-5310</p>Degré de pureté :Min. 95%Rat MIP3 α ELISA Kit
<p>ELISA Kit for detection of MIP3 alpha in the research laboratory</p>Degré de pureté :Min. 95%Toxoplasma gondii IgM ELISA kit
<p>ELISA kit for the detection of Toxoplasma gondii IgM in the research laboratory</p>Degré de pureté :Min. 95%Parietal Cell ELISA kit
<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>Degré de pureté :Min. 95%Dengue Virus IgM ELISA kit
<p>ELISA kit for the detection of Dengue Virus IgM in the research laboratory</p>Degré de pureté :Min. 95%SPOPL Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPOPL antibody, catalog no. 70R-8870</p>Degré de pureté :Min. 95%Human β 2 Microglobulin ELISA kit
<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>Degré de pureté :Min. 95%TSH beta antibody F(ab)'2 Fragment
<p>TSH beta antibody was raised against Human TSH (intact).</p>Degré de pureté :Min. 95%Porcine Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Degré de pureté :Min. 95%Mouse IL16 ELISA kit
<p>ELISA Kit for detection of IL16 in the research laboratory</p>Degré de pureté :Min. 95%Human IL4 ELISA Kit
<p>ELISA kit for detection of Human IL4 in the research laboratory</p>Degré de pureté :Min. 95%Goat anti Rabbit IgG (H + L) (biotin)
<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>Degré de pureté :Min. 95%Adrenaline/Noradrenaline ELISA Kit (2-CAT)
<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>Degré de pureté :Min. 95%Human Mullerian hormone ELISA kit
<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>Degré de pureté :Min. 95%PSA ELISA Kit
<p>ELISA kit for detection of PSA in the research laboratory</p>Degré de pureté :Min. 95%Mouse Oxytocin ELISA kit
<p>ELISA Kit for detection of Oxytocin in the research laboratory</p>Degré de pureté :Min. 95%Rabbit anti Goat IgG (H + L) (Alk Phos)
<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>Degré de pureté :Min. 95%α Fodrin ELISA kit
<p>ELISA kit for the detection of Alpha Fodrin in the research laboratory</p>Degré de pureté :Min. 95%Thyroglobulin ELISA kit
<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>Degré de pureté :Min. 95%Rheumatoid Factor IgM ELISA kit
<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>Degré de pureté :Min. 95%ANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%Cathepsin G ELISA kit
<p>ELISA kit for the detection of Cathepsin G in the research laboratory</p>Degré de pureté :Min. 95%Mac2BP ELISA kit
<p>ELISA kit for the detection of Mac2BP in the research laboratory</p>Degré de pureté :Min. 95%Rat Histamine ELISA kit
<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>Degré de pureté :Min. 95%Histamine release ELISA kit
<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>Degré de pureté :Min. 95%SNIPER(ABL)-058
CAS :<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>Formule :C62H75N11O9SDegré de pureté :Min. 95%Masse moléculaire :1,150.4 g/molTPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>Thyroid peroxidase ELISA kit
<p>ELISA kit for the detection of Thyroid peroxidase in the research laboratory</p>Degré de pureté :Min. 95%PDE3B antibody
<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>Bovine Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Degré de pureté :Min. 95%Human TIMP2 ELISA Kit
<p>ELISA kit for detection of TIMP2 in the research laboratory</p>Degré de pureté :Min. 95%Rat CRP ELISA kit
<p>ELISA kit for the detection of Rat CRP in the research laboratory</p>Degré de pureté :Min. 95%Human IgM ELISA kit
<p>ELISA Kit for detection of IgM in the research laboratory</p>Degré de pureté :Min. 95%Hamster CHO Annexin A5 ELISA Kit
<p>Hamster (CHO) Annexin A5 ELISA Kit<br>Â <br>Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.</p>Degré de pureté :Min. 95%Rat IgA ELISA Kit
<p>Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgG2B ELISA Kit
<p>Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human α 1-Microglobulin ELISA Kit
<p>Please enquire for more information about Human Alpha 1-Microglobulin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse Ferritin ELISA Kit
<p>Please enquire for more information about Mouse Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human AGP ELISA Kit
<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>Degré de pureté :Min. 95%anti-Human Procalcitonin (PCT) Antibody
<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>Degré de pureté :Min. 95%Mouse SAA ELISA Kit
<p>Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Dysprosium(III) bromide
CAS :<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>Formule :Br3DyDegré de pureté :Min. 95%Masse moléculaire :402.21 g/molHuman PDGFAB ELISA Kit
<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>Degré de pureté :Min. 95%MEF2A antibody
<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>Degré de pureté :Min. 95%Monkey IgG ELISA Kit
<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>Degré de pureté :Min. 95%HO1, gst tagged human
CAS :<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>Degré de pureté :Min. 95%Pig CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>Degré de pureté :Min. 95%Rat TrkA ELISA Kit
<p>ELISA kit for detection of TrkA in the research laboratory</p>Degré de pureté :Min. 95%CHO CTSA ELISA Kit
<p>Please enquire for more information about CHO CTSA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat B2M ELISA Kit
<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Degré de pureté :Min. 95%Bestatin-amido-Me
CAS :<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>Formule :C17H27N3O3Degré de pureté :Min. 95%Masse moléculaire :321.4 g/mol(R)-DPN
CAS :<p>(R)-DPN is a selective agonist, which is a chemical compound primarily sourced through synthetic organic chemistry techniques. Its mode of action involves specifically binding to and activating the estrogen-related receptor gamma (ERRγ), a member of the nuclear receptor superfamily. By acting as a highly selective ligand, (R)-DPN modulates the transcriptional activity associated with the ERRγ receptor, influencing various biological pathways.</p>Formule :C15H13NO2Degré de pureté :Min. 95%Masse moléculaire :239.27 g/molKY1220
CAS :<p>KY1220 is a molecule that destabilizes the activated state of PD-L1, which is a regulatory protein. KY1220 has been shown to enhance the effect of cancer cell death and inhibit metastatic colorectal cancer in mice. It was also found to be more effective than PD-L1 antibodies in reducing tumor size and inhibiting tumor growth. KY1220 has been shown to synergistically enhance the cytotoxic effects of other chemotherapeutic drugs on cancer tissues. This drug may be useful for treating patients with metastatic colorectal cancer or those who are resistant to PD-L1 antibodies.</p>Formule :C14H10N4O3SDegré de pureté :Min. 95%Masse moléculaire :314.32 g/molEndothelin A Receptor antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>Rat MMP2 ELISA Kit
<p>ELISA kit for detection of MMP2 in the research laboratory</p>Degré de pureté :Min. 95%Grams iodine stain
CAS :<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>Formule :I3K3Degré de pureté :Min. 95%Masse moléculaire :498.01 g/molRat Lipocalin 2 ELISA Kit
<p>ELISA kit for detection of Lipocalin 2 in the research laboratory</p>Degré de pureté :Min. 95%IGFBP1 ELISA kit
<p>ELISA kit for the detection of IGFBP1 in the research laboratory</p>Degré de pureté :Min. 95%Human CXCL10 ELISA Kit
<p>ELISA kit for detection of CXCL10 in the research laboratory</p>Degré de pureté :Min. 95%Mouse Free Thyroxine ELISA kit
<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>Degré de pureté :Min. 95%Prolactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H244N54O41SMasse moléculaire :3,576.01 g/mol05:0 PC
CAS :<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Formule :C18H36NO8PDegré de pureté :Min. 95%Masse moléculaire :425.45 g/molHead activator
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molAmyloid beta-Protein (36-38)
CAS :<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Formule :C9H17N3O4Degré de pureté :Min. 95%Masse moléculaire :231.25 g/molMesotocin trifluroacetate
CAS :<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Formule :C43H66N12O12S2Degré de pureté :Min. 95%Masse moléculaire :1,007.19 g/mol[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H94N20O21Masse moléculaire :1,371.48 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/molH-His-Arg-OH
CAS :<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/molCJC-1295
CAS :<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Degré de pureté :Min. 95%
