Produits biochimiques et réactifs

<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>

<p>ELISA Kit for detection of IL23 in the research laboratory</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA kit for detection of Progesterone in the research laboratory</p>

<p>ELISA kit for the detection of Centromere B in the research laboratory</p>

<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>

<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>

<p>ELISA kit for detection of Dihydrotestosterone in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPOPL antibody, catalog no. 70R-8870</p>

<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>

<p>ELISA kit for detection of Rubella in the research laboratory</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134</p>

<p>ELISA kit for the detection of SSA  in the research laboratory</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>Please enquire for more information about Dog IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>

<p>Inhibitor of p38 MAPK kinase</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>

<p>Mots-C is a mitochondrial-derived peptide, which is encoded by the small open reading frame found within the mitochondrial 12S rRNA. This peptide functions by interacting with the cellular metabolic pathways to enhance mitochondrial bioenergetics and overall cellular metabolism. Mechanistically, Mots-C modulates the folate–methionine cycle, directly impacting glucose regulation and energy utilization, and consequently facilitating cellular adaptation to metabolic stress.</p>

<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>

<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>

<p>Thymus factor X is a protein that has been shown to inhibit proliferation of cancer cells in animal models. It has also been shown to have an inhibitory effect on the growth of mesenteric cancer cells and on human hepatitis B virus. Thymus factor X is a basic protein that stimulates apoptosis, or programmed cell death, by binding to monoclonal antibodies and triggering cellular events that lead to the breakdown of DNA. It also inhibits production of inflammatory cytokines in response to skin tests. Thymus factor X is active against infectious diseases such as tuberculosis, bacterial pneumonia, and chickenpox. The drug is currently being studied for use in treating primary sclerosing cholangitis, which is a chronic inflammatory disease of the bile ducts.<br>Thymus Factor X may be used therapeutically for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, but further research needs to be done before it can be approved for any therapeutic purposes.</p>

<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>

<p>Gadolinium(III) bromide is a salt of gadolinium with the chemical formula GdBr3. It is a colorless solid that can be obtained as long, needle-like crystals. Gadolinium(III) bromide is used to produce a variety of gadolinium compounds, such as gadopentetate dimeglumine, which is used for MRI contrast enhancement. The compound's vapor pressure is 1.5 x 10-4 torr at room temperature and its evaporation point is 292 °C (550 °F).<br><br>Gadolinium(III) bromide has been shown to have replicating properties in experimental systems. These properties are determined by the size of the system and the parameters involved in the reaction yield, transition state, and stoichiometry.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA kit for detection of TIMP2 in the research laboratory</p>

<p>ELISA Kit for detection of IgM in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA Kit for detection of CEA in the research laboratory</p>

<p>5HIAA ELISA Kit for the quantitative determination of 5HIAA in urine</p>

<p>ELISA Kit for detection of AVP in the research laboratory</p>

<p>ELISA kit for detection of Histamine in the research laboratory</p>

<p>Salivary sample collection kit for the detection of free Salivary proteins and enzymes in the research laboratory</p>

<p>ELISA Kit for detection of IL16 in the research laboratory</p>

<p>ELISA kit for detection of Human IL4 in the research laboratory</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>

<p>Goat anti Human IgE antibody</p>

<p>Please enquire for more information about Human Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione is a potent chemokine molecule that is an agonist of the CXCR2 receptor. It has been shown to inhibit cancer stem cells and chemoattractant production in colon carcinoma cells. This compound selectively targets the translation of lamiaceae mRNA and induces apoptosis in colon carcinoma cells.</p>

<p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of &gt; 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>

<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>

<p>SR-4370 is a potent inhibitor of the histone deacetylase (HDAC) enzyme class. It has been shown to inhibit cholesterol synthesis and lipid biosynthesis in cells, as well as inhibiting cancer cell proliferation. SR-4370 also has antioxidant effects, which may be due to its ability to inhibit the activation of NF-κB and downstream mediators. In addition, this compound has been shown to have synergistic effects with other HDAC inhibitors and chemotherapy drugs. This drug is being developed for the treatment of cancers such as prostate cancer, melanoma, breast cancer, colon cancer, and head and neck cancer.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Purified Cat/Feline Haptoglobin</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Calibrator for Chicken ELISA Kit</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>

<p>Human Myoglobin ELISA Kit</p>

<p>Cat Haptoglobin ELISA Kit</p>

<p>The Goat IgG ELISA kit is intended for the quantitative determination of total goat IgG in biological samples. This product will not react with sheep IgG or Bovine IgG.</p>

<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Cat SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in feline samples.</p>

<p>SARS-CoV-2 Spike RBD Antibody Pair 1</p>

<p>ELISA kit for the detection of GBM in the research laboratory</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>ELISA kit for detection of Cystatin C in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA Kit for detection of Triiodothyronine in the research laboratory</p>

<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified recombinant LGALS1 protein (His tag)</p>

<p>ELISA kit for the detection of IGFBP1 in the research laboratory</p>

<p>ELISA kit for detection of CXCL10 in the research laboratory</p>

<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>

<p>ELISA kit for detection of OPN in the research laboratory</p>

<p>ELISA kit for the detection of TNF alpha in the research laboratory</p>

<p>ELISA kit for detection of Mouse RANKL in the research laboratory</p>

<p>ELISA kit for detection of Rat PAI1 in the research laboratory</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>ELISA Kit for detection of TPO in the research laboratory</p>

<p>Azido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>

<p>(R)-Funapide is a ligand that binds to the activator site of the nicotinic acetylcholine receptor (nAChR) and has been shown to activate this receptor. It is used as a research tool in cell biology, ion channels, peptides, and antibodies. (R)-Funapide has also been shown to inhibit protein interactions with a number of different receptors.</p>

<p>ELISA kit for the detection of CA 15-3 in the research laboratory</p>

<p>Human KLK2(Kallikrein-2) ELISA Kit</p>

<p>ELISA kit for detection of BAFF in the research laboratory</p>

<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgA in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>

<p>This antibody reacts with heavy (mu) chains on mouse IgM.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRAS antibody, catalog no. 70R-5673</p>

<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>

<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>

<p>Human IgG &amp; IgM Primer Set</p>

<p>ELISA kit for the detection of PTH intact in the research laboratory</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>ELISA kit for detection of RBP4 in the research laboratory</p>

<p>ELISA kit for the detection of Annexin V in the research laboratory</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>

<p>ELISA kit for the detection of Nucleosome in the research laboratory</p>

<p>Folic Acid protein is a versatile compound widely used in Life Sciences. It has various applications, including its role as an anti-HER2 antibody in human serum. Folic Acid protein interacts with insulin and epidermal growth factor, making it essential for cellular processes and growth regulation. Additionally, it has been found to have autoantibodies and acidic properties that contribute to its effectiveness as a growth factor. Folic Acid protein also exhibits anti-glial fibrillary acidic properties, which can be beneficial in certain medical conditions. With its unique amino group and carbonyl group composition, Folic Acid protein plays a crucial role in the development of insulins and other Recombinant Proteins &amp; Antigens. Moreover, it has shown promising results when combined with trastuzumab, an anti-glial fibrillary antibody used in cancer treatment.</p>

<p>Monkey Red Blood Cells are a valuable resource in the field of Life Sciences. These cells can be used for various applications such as studying the angiotensin-converting enzyme, neutralizing antibodies, and electrode development. Monkey Red Blood Cells are often used in research to develop monoclonal antibodies and pegylated products. They can also be used as biospecimens for the analysis of serum, plasma, and other fluids. Additionally, Monkey Red Blood Cells have been utilized in studies involving collagen, human serum, peptide agents, influenza hemagglutinin, brucella abortus, carbon quantum dots, chemokines, and growth factors. These cells offer researchers a reliable and versatile tool for their scientific investigations.</p>

<p>ELISA kit for detection of IGF1 in the research laboratory</p>

<p>KRT16 antibody was raised in Rabbit using Human KRT16 as the immunogen</p>

<p>ELISA Kit for detection of SCF in the research laboratory</p>

<p>ELISA kit for the detection of ANCA combi in the research laboratory</p>

<p>ELISA kit for detection of Human IL10 in the research laboratory</p>

<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>

<p>ELISA kit for the detection of EPO in the research laboratory</p>

<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>ELISA Kit for detection of IgM in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin IgG in the research laboratory</p>

<p>ELISA kit for detection of IGF1 in the research laboratory</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H &amp; L) as the immunogen.</p>

<p>Please enquire for more information about Human Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dog Osteopontin ELISA Kit - OPN is confined to the distal parts of a subset of nephrons. In the kidney the expression of OPN is severely upregulated during renal injury.Â</p>

<p>Rat Myoglobin ELISA Kit</p>

<p>Human Apolipoprotein H ELISA Kit</p>

<p>Ready to use Dog/Canine Cystatin C ELISA Kit</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>

<p>Hamster (CHO) Nidogen-1 ELISA Kit<br> <br>Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.</p>

<p>Cat IgE ELISA Kit</p>

<p>Monkey Cystatin C ELISA Kit</p>

<p>Quantify pig albumin in your samples.</p>

<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>

<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>

<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>

<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>

<p>Rabbit IgA ELISA Kit</p>

<p>Rat Fatty Acid Binding Protein ELISA Kit</p>

<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>

<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>

<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>

<p>Rabbit Plasminogen ELISA Kit</p>

<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>

<p>Sheep Haptoglobin ELISA Kit;</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>