Produits biochimiques et réactifs

<p>Please enquire for more information about Bovine Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of P-Selectin in the research laboratory</p>

<p>Please enquire for more information about 1,9-Dichloro-3,7-diazanonane dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ready to use Cat/Feline AGP ELISA Kit</p>

<p>Human Ceruloplasmin ELISA kit is intended for the quantitative determination of total human ceruloplasmin in biological samples.</p>

<p>The Caspase 1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets caspase 1, an enzyme involved in various cellular processes such as apoptosis and inflammation. This antibody specifically recognizes and binds to caspase 1, allowing for its detection and analysis.</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>Please enquire for more information about Human Alpha 1-Antichymotrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse Plasminogen ELISA Kit</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>Horse CRP ELISA Kit</p>

<p>Please enquire for more information about Rat Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat GST alpha ELISA Kit</p>

<p>For the quantitative determination of canine/dog albumin in biological samples.</p>

<p>ELISA kit for the detection of CA 15-3 in the research laboratory</p>

<p>Bovine Transferrin ELISA Kit</p>

<p>Please enquire for more information about Dog IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human KLK2(Kallikrein-2) ELISA Kit</p>

<p>Cat IgE ELISA Kit</p>

<p>3-Hydroxy donepezil is a byproduct of the chemical reaction that converts donepezil to its active form. It is an inhibitor of the acetylcholinesterase enzyme, which breaks down the neurotransmitter acetylcholine. 3-Hydroxy donepezil has been shown to be a high purity and potent inhibitor of acetylcholinesterase, with IC50 values in the low nanomolar range.</p>

<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>Purified recombinant protein from a sequence within the PEDV Spike Protein (S1) domain. Expressed and purified from CHO cells and contains a 6xHIS tag.</p>

<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dog Alpha 1-Acid Glycoprotein ELISA Kit</p>

<p>Hamster (CHO) Nidogen-1 ELISA Kit<br> <br>Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Purified Cat/Feline Haptoglobin</p>

<p>Borrelia burgdorferi (Lyme disease) OspA Protein is a highly purified HIS tagged recombinant protein that is derived from E.coli.</p>

<p>Mouse Fibronectin ELISA Kit</p>

<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA kit for the detection of LH in the research laboratory</p>

<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Human sequence expressed in E. coli Cells; purity &gt;97% by SDS-PAGE and analyzed by silver stain.</p>

<p>Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1. Activates TRPV1 receptor, which is involved in the transmission of pain signals and the release of inflammatory mediators<br>2. Binds to and activates P2X7 receptors, which are associated with cell death and inflammation<br>3. Blocks voltage-gated calcium channels, which play a role in neuronal excitability and muscle contraction<br>4. Inhibits the activity of MAP kinase phosphatases, which are involved in regulating the activation of MAP kinase <br>5. Stimulates ligand-gated ion channels such as nicotinic acetylcholine receptors (nAChRs) <br>6. Binds to GABA receptors, inhibiting the effects of GABA on neurons <br>7. Acts as an antagonist at dopamine D2 receptors <br>8. Binds to muscarinic M1/M3 receptors, inhibiting acetylcholine release <br>9. Binds to alpha-adrenergic receptors, leading to vas</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>Ready to use Dog/Canine Cystatin C ELISA Kit</p>

<p>ELISA kit for the detection of Sperm Antibodies in the research laboratory</p>

<p>Human Apolipoprotein H ELISA Kit</p>

<p>Rat Myoglobin ELISA Kit</p>

<p>Dog Osteopontin ELISA Kit - OPN is confined to the distal parts of a subset of nephrons. In the kidney the expression of OPN is severely upregulated during renal injury.Â</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>

<p>ELISA kit for the detection of Calcitonin in the research laboratory</p>

<p>Please enquire for more information about Human Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cortisol ELISA Kit for the determination of cortisol in human serum and plasma</p>

<p>Luteolin 7-sulfate is a flavonoid that is found in plants. It can be extracted from the leaves of many plants, including the flowers of chamomile and lavender. Luteolin 7-sulfate has been shown to inhibit tyrosinase activity, which may be related to its ability to act as a transcriptional modulator of gene expression. This compound has also demonstrated antimicrobial activity against human epidermal keratinocytes and murine melanoma cells. Luteolin 7-sulfate belongs to the class of flavones, which are characterized by their two phenolic rings that are attached at positions 3' and 4'. The sulphates on luteolin 7-sulfate are located at positions 3' and 4'.</p>

<p>ELISA kit for the detection of Centromere B in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FN3KRP antibody, catalog no. 70R-3288</p>

<p>ELISA kit for the detection of PTH intact in the research laboratory</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>ELISA Kit for detection of IL23 in the research laboratory</p>

<p>ELISA kit for the detection of ENA in the research laboratory</p>

<p>ELISA kit for the detection of Annexin V in the research laboratory</p>

<p>ELISA kit for detection of MIF in the research laboratory</p>

<p>ELISA Kit for detection of IL12 (p70) in the research laboratory</p>

<p>ELISA Kit for detection of Mouse Coagulation Factor III in the research laboratory</p>

<p>ELISA kit for detection of VCAM1 in the research laboratory</p>

<p>Gadolinium(III) bromide is a salt of gadolinium with the chemical formula GdBr3. It is a colorless solid that can be obtained as long, needle-like crystals. Gadolinium(III) bromide is used to produce a variety of gadolinium compounds, such as gadopentetate dimeglumine, which is used for MRI contrast enhancement. The compound's vapor pressure is 1.5 x 10-4 torr at room temperature and its evaporation point is 292 °C (550 °F).<br><br>Gadolinium(III) bromide has been shown to have replicating properties in experimental systems. These properties are determined by the size of the system and the parameters involved in the reaction yield, transition state, and stoichiometry.</p>

<p>ELISA kit for detection of IGF2 in the research laboratory</p>

<p>Human sequence expressed in CHO Cells; purity &gt;95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>

<p>ELISA kit for detection of Progesterone in the research laboratory</p>

<p>ELISA Kit for detection of von Willebrand Factor in the research laboratory</p>

<p>The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.</p>

<p>PQR626 is a human analog of astaxanthin, a carotenoid with strong antioxidant properties. It has been shown to have anti-cancer effects by inhibiting the activity of trypsin-like proteases and kinases involved in tumor cell growth and survival. PQR626 induces apoptosis in cancer cells and has been investigated as a potential treatment for various types of cancer, including Chinese hamster ovary cells and prostate cancer. This compound also shows promise as an inhibitor of rifampicin-induced urinary excretion, which may increase the bioavailability of other drugs.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA Kit for detection of HCG in the research laboratory</p>

<p>Cat IgM ELISA Kit</p>

<p>ELISA kit for the detection of SSA in the research laboratory</p>

<p>Inhibitor of p38 MAPK kinase</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Ferumoxytol is used in magnetic resonance imaging (MRI) to improve the quality of images. It is given intravenously and is excreted unchanged by the kidneys. Ferumoxytol has been shown to be safe and effective for diagnosing bowel disease, including Crohn's disease, ulcerative colitis, and diverticulitis. Ferumoxytol also has been shown to be useful in evaluating cardiac function before and after myocardial infarction. Ferumoxytol has a low toxicity profile with no significant adverse effects reported during clinical trials.</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Hydroxy indacaterol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>

<p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Bnc2 antibody, catalog no. 70R-8331</p>

<p>ELISA kit for the detection of EPO in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>The CD80 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD80, a protein involved in immune responses and cell signaling. This antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FMOD antibody, catalog no. 70R-5310</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgM in the research laboratory</p>

<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>Recombinant Mouse MASP2 protein</p>

<p>The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.</p>

<p>Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>

<p>Please enquire for more information about Human A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PBB 10 is a monoclonal antibody that binds to the antigen on the surface of cells. It is used in immunocytochemical staining and immunohistochemical staining techniques, as well as in ELISA assays. PBB 10 can be used for the detection of brominated biphenyls (PBBs) in liquid samples that are either incubated or not incubated with a brominating agent. PBB 10 can be used for the detection of polychlorinated biphenyls (PCBs) in dry samples that are debrominated before analysis. The antibody is also useful for detecting PCBs in tissues from laboratory animals. PBB 10 stains neural tissue and has been shown to be a ligand for certain receptors in the nervous system.</p>

<p>Rat KIM-1 ELISA Kit</p>

<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>

<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>

<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>

<p>Antagonist of histamine receptor H4</p>

<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>

<p>Mouse Fetuin/AHSG ELISA Kit.</p>

<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>

<p>CP-724714 is a small molecule that is able to inhibit the growth of cancer cells. It has been shown to be effective against HER2+ breast cancer, colorectal carcinoma cell lines, and lung carcinoma cell lines. CP-724714 causes cell cycle arrest by inhibiting the production of proteins required for DNA replication and repair. Cell proliferation inhibition can also be achieved by blocking epidermal growth factor receptors or other growth factors such as platelet-derived growth factor (PDGF). The mechanism of action may involve interference with the activation of protein kinase B (PKB), which is involved in cell signaling pathways. CP-724714 has been studied in both cell culture and clinical studies for its biological function as a cancer therapeutic agent.</p>

<p>Azido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Denaverine hydrochloride is a research tool with the ability to activate receptors and ion channels. It has been used to study protein interactions and pharmacology. Denaverine hydrochloride has been shown to inhibit the activity of acetylcholine esterase, which is an enzyme that breaks down acetylcholine. This research tool has also been used as a ligand in antibody binding studies, and it is widely used in cell biology experiments for its ability to bind proteins. Denaverine hydrochloride is soluble in water and does not contain any impurities or toxic substances.</p>

<p>Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen</p>

<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>

<p>Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.<br>INSULIN CAN BE USED TO:<br>- Measure blood sugar levels<br>- Monitor diabetes<br>- Treat diabetes<br>- Control weight gain<br>- Improve muscle mass</p>

<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>

<p>Rat Plasminogen ELISA Kit</p>

<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>

<p>ELISA Kit for detection of VEGF in the research laboratory</p>

<p>Guinea Pig C3 ELISA Kit</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Vamp1 antibody, catalog no. 70R-9794</p>

<p>Wf-516 is a peptide that activates the G protein-coupled receptor, P2Y. It has been shown to be a potent inhibitor of ion channels and ligands, such as ATP, ADP, AMP, UDP-glucose and adenosine. Wf-516 has also been shown to inhibit the activity of the ligand binding domain of the human erythropoietin receptor (EPOR) in cultured cells. This drug is used as a research tool for studying cell biology and pharmacology.</p>

<p>Please enquire for more information about Dog IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pig Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The VIM antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of interleukin-6 (IL-6), a key growth factor involved in various physiological processes. By inhibiting IL-6, the VIM antibody helps regulate immune responses and reduce inflammation. Additionally, this antibody has been shown to inhibit the production of superoxide, which plays a role in oxidative stress.</p>

<p>Please enquire for more information about Rat Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OPTC antibody, catalog no. 70R-5283</p>

<p>Inhibitor of SYK kinase</p>

<p>ELISA kit for the detection of CA 199 in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA1 antibody, catalog no. 70R-8182</p>

<p>Troponin1 is a protein that is found in the muscle cells of humans. Troponin1 binds to actin, tropomyosin, and troponin C, which are proteins that make up the thin filament of the sarcomere. Tropomyosin blocks actin binding sites on the thin filament and prevents cross-bridge formation. When tropomyosin is displaced by troponins, it exposes these sites for interaction with myosin heads, which form cross-bridges with actin. Troponins also regulate calcium release from the sarcoplasmic reticulum during excitation-contraction coupling. The human troponins are encoded by different genes and are identified as TNN1 (Troponin 1), TNN2 (Troponin 2), TNN3 (Troponin 3), or TNN4 (Troponin 4). This antibody reacts with human cardiac and skeletal muscle tropomyosins and not</p>

<p>Purified recombinant nrdD protein (His tag)</p>

<p>ELISA kit for the detection of PGE2 in the research laboratory</p>

<p>ELISA kit for detection of Dihydrotestosterone in the research laboratory</p>

<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>

<p>KY1220 is a molecule that destabilizes the activated state of PD-L1, which is a regulatory protein. KY1220 has been shown to enhance the effect of cancer cell death and inhibit metastatic colorectal cancer in mice. It was also found to be more effective than PD-L1 antibodies in reducing tumor size and inhibiting tumor growth. KY1220 has been shown to synergistically enhance the cytotoxic effects of other chemotherapeutic drugs on cancer tissues. This drug may be useful for treating patients with metastatic colorectal cancer or those who are resistant to PD-L1 antibodies.</p>

<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>

<p>(R)-Funapide is a ligand that binds to the activator site of the nicotinic acetylcholine receptor (nAChR) and has been shown to activate this receptor. It is used as a research tool in cell biology, ion channels, peptides, and antibodies. (R)-Funapide has also been shown to inhibit protein interactions with a number of different receptors.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>

<p>ELISA kit for detection of PSA in the research laboratory</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>

<p>Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHEK1 antibody, catalog no. 70R-5597</p>

<p>ELISA kit for detection of TIMP2 in the research laboratory</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>Rabbit polyclonal POLD2 antibody</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>1-261 amino acids: MAESHLQSSL ITASQFFEIW LHFDADGSGY LEGKELQNLI QELQQARKKA GLELSPEMKT FVDQYGQRDD GKIGIVELAH VLPTEENFLL LFRCQQLKSC EEFMKTWRKY DTDHSGFIET EELKNFLKDL LEKANKTVDD TKLAEYTDLM LKLFDSNNDG KLELTEMARL LPVQENFLLK FQGIKMCGKE FNKAFELYDQ DGNGYIDENE LDALLKDLCE KNKQDLDINN ITTYKKNIMA LSDGGKLYRT DLALILCAGD N</p>

<p>Arabidopsis Thaliana Plant Lysate</p>

<p>AMBMP Hydrochloride is a synthetic compound, specifically designed for research purposes in the field of neuroscience. This compound is derived from a series of carefully crafted chemical reactions, typically originating from a laboratory setting specializing in organic synthesis. Its primary mode of action is as a selective ligand targeting specific receptors within the central nervous system, allowing researchers to investigate receptor function and signaling pathways with precision.</p>

<p>Goat anti Human IgE antibody</p>

<p>MFF antibody was raised in Rabbit using Human MFF as the immunogen</p>

<p>ELISA Kit for detection of IFNb in the research laboratory</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>