Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.129 produits)
- Par Biological Target(99.160 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.742 produits)
- Métabolites secondaires(14.222 produits)
130579 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
GSTZ1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTZ1 antibody, catalog no. 70R-1182</p>Degré de pureté :Min. 95%FKBP6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FKBP6 antibody, catalog no. 70R-1079</p>Degré de pureté :Min. 95%Rabbit anti Chicken IgG (H + L) (HRP)
<p>Rabbit anti-chicken IgG (H+L) (HRP) was raised in rabbit using chicken IgG whole molecule as the immunogen.</p>Degré de pureté :Min. 95%Biliverdin reductase A protein
<p>3-296 amino acids: MAEPERKFGV VVVGVGRAGS VRMRDLRNPH PSSAFLNLIG FVSRRELGSI DGVQQISLED ALSSQEVEVA YICSESSSHE DYIRQFLNAG KHVLVEYPMT LSLAAAQELW ELAEQKGKVL HEEHVELLME EFAFLKKEVV GKDLLKGSLL FTAGPLEEER FGFPAFSGIS RLTWLVSLFG ELSLVSATLE ERKEDQYMKM TVCLETEKKS PLSWIEEKGP GLKRNRYLSF HFKSGSLENV PNVGVNKNIF LKDQNIFVQK LLGQFSEKEL AAEKKRILHC LGLAEEIQKY CCSRK</p>Degré de pureté :Min. 95%SPAG8 antibody
<p>SPAG8 antibody was raised using the middle region of SPAG8 corresponding to a region with amino acids PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT</p>TGFR3 antibody
<p>TGFR3 antibody is a polyclonal antibody that specifically targets the TGFR3 protein. It is commonly used in life sciences research to study the role of TGFR3 in various cellular processes. This antibody can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.</p>TNFSF9 antibody
<p>The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.</p>KYNU antibody
<p>KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK</p>DHDDS Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHDDS antibody, catalog no. 70R-3031</p>Degré de pureté :Min. 95%Protein A protein
<p>37-469 amino acids: MAQHDEAQQN AFYQVLNMPN LNADQRNGFI QSLKDDPSQS ANVLGEAQKL NDSQAPKADA QQNNFNKDQQ SAFYEILNMP NLNEAQRNGF IQSLKDDPSQ STNVLGEAKK LNESQAPKAD NNFNKEQQNA FYEILNMPNL NEEQRNGFIQ SLKDDPSQSA NLLSEAKKLN ESQAPKADNK FNKEQQNAFY EILHLPNLNE EQRNGFIQSL KDDPSQSANL LAEAKKLNDA QAPKADNKFN KEQQNAFYEI LHLPNLTEEQ RNGFIQSLKD DPSVSKEILA EAKKLNDAQA PKEEDNNKPG KEDNNKPGKE DNNKPGKEDG NKPGKEDNKK PGKEDNKKPG KEDNKKPGKE DGNKPGKEDN KKPGKEDGNG VHVVKPGDTV NDIAKANGTT ADKIAADNKL ADKNMIKPGQ ELVVDKKQPA NHADANKAQA LPET</p>Degré de pureté :Min. 95%CHRNB2 antibody
<p>CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI</p>Sdc3 antibody
<p>Sdc3 antibody was raised in rabbit using the N terminal of Sdc3 as the immunogen. Synthetic peptide located within the following region: GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL</p>Degré de pureté :Min. 95%B3galnt1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B3galnt1 antibody, catalog no. 70R-8608</p>Degré de pureté :Min. 95%INSR Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INSR antibody, catalog no. 70R-7510</p>Degré de pureté :Min. 95%PLP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLP1 antibody, catalog no. 70R-7002</p>Degré de pureté :Min. 95%CD9 antibody (Azide Free)
<p>CD9 antibody (Azide free) was raised in mouse using human CD9 as the immunogen.</p>TMCC1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMCC1 antibody, catalog no. 70R-6826</p>Degré de pureté :Min. 95%BAK1 antibody
<p>The BAK1 antibody is a test compound used in Life Sciences research. It is a protein reagent that is commonly used in the field of Antibodies. This antibody specifically targets hematopoietic cells and can be used to study their function in various biological processes. The BAK1 antibody has high affinity for its target and can be used as an inhibitor to block specific interactions or signaling pathways. Additionally, it has been shown to have therapeutic potential in the field of pluripotent stem cell research, where it can be used to manipulate DNA double-strand breaks and promote cellular differentiation. With its versatility and wide range of applications, the BAK1 antibody is an essential tool for researchers in the Life Sciences field.</p>LIPG Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LIPG antibody, catalog no. 70R-7841</p>Degré de pureté :Min. 95%Dopamine β Hydroxylase antibody
<p>The Dopamine beta Hydroxylase antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to dopamine beta hydroxylase, an enzyme involved in the synthesis of norepinephrine. This antibody is commonly used in research and diagnostic assays to study the role of dopamine beta hydroxylase in various biological processes.</p>SOS2 antibody
<p>The SOS2 antibody is a polyclonal antibody that specifically binds to actin filaments. It has high affinity for actin and can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. The antibody shows strong binding to actin in human serum and has been used to detect autoantibodies in autoimmune diseases. Additionally, the SOS2 antibody can bind to other proteins such as serum albumin, cation, cellulose, arginase, glutamate, and fatty acid. Its ability to form disulfide bonds ensures stability and reliable performance in experiments. Whether you're studying cell biology or conducting research on protein interactions, the SOS2 antibody is an essential tool for your laboratory.</p>Cyclin J Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCNJ antibody, catalog no. 70R-3737</p>Degré de pureté :Min. 95%SSX8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSX8 antibody, catalog no. 70R-9114</p>Degré de pureté :Min. 95%Staphylococcus aureus antibody (HRP)
<p>Staphylococcus aureus antibody (HRP) was raised in rabbit using ATCC 27660 as the immunogen.</p>NAP1L2 antibody
<p>NAP1L2 antibody was raised using the middle region of NAP1L2 corresponding to a region with amino acids VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE</p>FCGR3A protein (His tag)
<p>Purified recombinant Human FCGR3A protein (His tag)</p>Degré de pureté :Min. 95%HSP90B1 antibody
<p>HSP90B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLD</p>Kaptin antibody
<p>Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL</p>LIMK1 antibody
<p>The LIMK1 antibody is a highly specialized insulin antibody that is used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and bind to activated LIMK1 protein. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>HTRA4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HTRA4 antibody, catalog no. 70R-7509</p>Degré de pureté :Min. 95%LRRC3 antibody
<p>LRRC3 antibody was raised using the middle region of LRRC3 corresponding to a region with amino acids TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA</p>Rabbit anti Cat IgG (FITC)
<p>Rabbit anti-cat IgG (FITC) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>Degré de pureté :Min. 95%RALGDS Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RALGDS antibody, catalog no. 70R-4313</p>Degré de pureté :Min. 95%UGT1A7 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGT1A7 antibody, catalog no. 70R-7305</p>Degré de pureté :Min. 95%ZNF572 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF572 antibody, catalog no. 70R-8425</p>Degré de pureté :Min. 95%RSAD2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RSAD2 antibody, catalog no. 70R-1595</p>Degré de pureté :Min. 95%SKF-89976A
CAS :<p>SKF-89976A is a potent, selective inhibitor of the uptake of the inhibitory neurotransmitter γ-aminobutyric acid (GABA) into synaptic vesicles. SKF-89976A has been shown to inhibit the uptake of GABA and diazepam in rat brain synaptosomes and to have antiepileptic activity in rats. It also binds to GABA receptors with low affinity. SKF-89976A has been localized to granule cell axons, where it inhibits GABA release, and to presynaptic terminals, where it inhibits GABA uptake. SKF-89976A is expressed in animals as well as in human tissues.<br>BR>BR><br>SKF-89976A was discovered by scientists at SmithKline Beecham Pharmaceuticals (now GlaxoSmithKline) who were looking for drugs that could raise seizure threshold levels during clinical trials on epilepsy patients.BR>BR><br>The drug was</p>Formule :C22H25NO2·HClDegré de pureté :Min. 95%Masse moléculaire :371.9 g/molTdp1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Tdp1 antibody, catalog no. 70R-9482</p>Degré de pureté :Min. 95%TRPV5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRPV5 antibody, catalog no. 70R-5176</p>Degré de pureté :Min. 95%FKBP2 protein
<p>22-142 amino acids: MATGAEGKRK LQIGVKKRVD HCPIKSRKGD VLHMHYTGKL EDGTEFDSSL PQNQPFVFSL GTGQVIKGWD QGLLGMCEGE KRKLVIPSEL GYGERGAPPK IPGGATLVFE VELLKIERRT EL</p>Degré de pureté :Min. 95%SLC25A42 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A42 antibody, catalog no. 70R-6513</p>Degré de pureté :Min. 95%Adiponectin protein (Mouse)
<p>Purified recombinant Adiponectin protein (Mouse)</p>Degré de pureté :Min. 95%Goat anti Human IgG (Fab'2)
<p>Goat anti-human IgG (Fab'2) was raised in goat using human IgG F(ab')2 fragment as the immunogen.</p>Degré de pureté :Min. 95%Ubiquilin 3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBQLN3 antibody, catalog no. 70R-2645</p>Degré de pureté :Min. 95%RAF1 antibody
<p>The RAF1 antibody is a monoclonal antibody that is commonly used in Life Sciences research. It specifically targets the CD33 protein, which is expressed on the surface of certain cells. This antibody can be used for a variety of applications, including immunohistochemistry, immunofluorescence, and flow cytometry.</p>Degré de pureté :Min. 95%PP2A antibody
<p>The PP2A antibody is a highly specialized monoclonal antibody that specifically targets the protein phosphatase 2A (PP2A). PP2A is an important regulator of cellular processes and functions by dephosphorylating various proteins involved in signal transduction pathways. This antibody has been extensively studied and proven to effectively inhibit the activity of PP2A, making it a valuable tool for researchers in the field of Life Sciences.</p>Streptavidin Poly-HRP20 Conjugate
<p>Streptavidin Poly-HRP20 Conjugate (diluted to 2 µg/mL in stabilizer 85R-1028).</p>Degré de pureté :Min. 95%ZNF154 antibody
<p>ZNF154 antibody was raised in rabbit using the N terminal of ZNF154 as the immunogen</p>Degré de pureté :Min. 95%SLC6A5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A5 antibody, catalog no. 70R-6566</p>Degré de pureté :Min. 95%TD1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TD1 antibody, catalog no. 70R-3036</p>Degré de pureté :Min. 95%Livin β protein (His tag)
<p>Purified recombinant Human Livin beta protein (His tag)</p>Degré de pureté :Min. 95%C1ORF75 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf75 antibody, catalog no. 70R-6574</p>CENTB5 antibody
<p>CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA</p>AGBL5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AGBL5 antibody, catalog no. 70R-3580</p>Degré de pureté :Min. 95%VDAC3 antibody
<p>VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE</p>TNRC18 antibody
<p>TNRC18 antibody was raised in rabbit using the N terminal of TNRC18 as the immunogen</p>Degré de pureté :Min. 95%GDF15 antibody
<p>The GDF15 antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It is designed to specifically target and neutralize adeno-associated virus (AAV) particles that are associated with endotoxemia. This antibody can be used in various applications, including immunohistochemistry and Western blotting, to detect the presence of GDF15 antigen. Additionally, it has been shown to have a high affinity for TRPV4, a calcium-permeable ion channel that plays a role in various physiological processes. The GDF15 antibody can also be used in combination with other antibodies, such as anti-CD33 antibody, to study the activation of specific signaling pathways or immune responses. With its specificity and versatility, this monoclonal antibody is an essential tool for researchers in the field of Life Sciences.</p>C20ORF141 antibody
<p>C20ORF141 antibody was raised using the middle region of C20Orf141 corresponding to a region with amino acids HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG</p>Cyclin-Dependent Kinase Inhibitor 2A, human, recombinant
<p>Cyclin-Dependent Kinase Inhibitor 2A (CDK2A) is a cyclin-dependent kinase inhibitor that inhibits the activity of cyclin-dependent kinases. CDK2A is a protein that belongs to the family of cyclin-dependent kinase inhibitors. It inhibits the activity of various cyclin-dependent kinases and prevents cell growth by suppressing protein synthesis. CDK2A is expressed in many human tissues, including erythrocytes, brain, heart, lung, muscle, pancreas, spleen, and testis. Cyclin-Dependent Kinase Inhibitor 2A can be used as an anti-cancer agent due to its ability to inhibit tumor proliferation.</p>Degré de pureté :Min. 95%ent-Voriconazole-d3
CAS :<p>Voriconazole is an antifungal agent that inhibits the synthesis of ergosterol, a component of fungal cell membranes. It binds to the cytochrome P450 enzyme, which is involved in the conversion of lanosterol to ergosterol. Voriconazole has been shown to have potent inhibitory effects on ion channels and protein interactions. It is also used as a research tool for studying protein-protein interactions and receptor pharmacology. This compound can be used as an activator or inhibitor depending on its target.</p>Formule :C16H11D3F3N5ODegré de pureté :Min. 95%Masse moléculaire :352.33 g/mol2-Aminofluorene-9-13C
CAS :<p>Please enquire for more information about 2-Aminofluorene-9-13C including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C13H11NDegré de pureté :Min. 95%Masse moléculaire :182.23 g/molPropiconazole-d7
CAS :<p>Propiconazole-d7 is an analog of the fungicide Propiconazole that has been deuterated at seven positions. It has been shown to have anticancer properties by inhibiting the activity of kinases, which are enzymes involved in cell signaling and proliferation. Propiconazole-d7 has been found to inhibit the activity of several kinases, including glycogen synthase kinase-3β (GSK-3β), cyclin-dependent kinase 2 (CDK2), and mitogen-activated protein kinase (MAPK). This inhibition leads to apoptosis or programmed cell death in cancer cells. Propiconazole-d7 has also been shown to inhibit the growth of human cancer cells, such as those derived from breast, lung, prostate, and liver tissues. In Chinese hamster ovary cells, it induces the accumulation of glycerol and indirubin, which are markers of apoptosis. Propiconazole-d7 may have potential as a therapeutic inhibitor for cancer treatment due to its</p>Formule :C15H17Cl2N3O2Degré de pureté :Min. 95%Masse moléculaire :347.2 g/molN-Biphenyl-4-yl-2-isopropylamino-acetamide
CAS :<p>Biphenyl-2-yl-4-(2-isopropylaminoacetamide) is a ligand that can bind to receptors and ion channels. It may also be used for research as a cell biology reagent, or as an antibody or inhibitor. The purity of this product is greater than 98% (HPLC).</p>Formule :C17H20N2ODegré de pureté :Min. 95%Masse moléculaire :268.35 g/molDronedarone C
CAS :<p>Please enquire for more information about Dronedarone C including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C19H19NO3Degré de pureté :Min. 95%Masse moléculaire :309.4 g/molNeuromedin S Precursor-Related Peptide 37 (Mouse)
<p>Neuromedin S Precursor-Related Peptide 37 (Mouse) is a peptide that activates the neuromedin S receptor. The receptor for neuromedin S precursor related peptide 37 is found in the central and peripheral nervous system, as well as in various other tissues. Neuromedin S precursor related peptide 37 is a ligand for the neuromedin S receptor and is an activator of ion channels. This molecule has been shown to inhibit protein interactions and has been used as a pharmacological agent in research to study protein interactions and ion channels.</p>Degré de pureté :Min. 95%TentaGel® Macrobead RAM particle size: 140 - 170 µm
<p>Please enquire for more information about TentaGel® Macrobead RAM particle size: 140 - 170 µm including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%C14ORF101 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14ORF101 antibody, catalog no. 70R-8031</p>Degré de pureté :Min. 95%FAM98A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM98A antibody, catalog no. 70R-4239</p>Degré de pureté :Min. 95%GPR75 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR75 antibody, catalog no. 70R-6305</p>Degré de pureté :Min. 95%IL1RL1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL1RL1 antibody, catalog no. 70R-7411</p>Degré de pureté :Min. 95%rpS6 antibody
<p>The rpS6 antibody is a polyclonal antibody that specifically targets fibrinogen, a cation-binding protein found in human serum. It is commonly used in life sciences research to study the antigen-antibody reaction and molecular weight complexes. The rpS6 antibody has high affinity and specificity for its target and can be used in various applications such as immunoprecipitation, Western blotting, and immunofluorescence. It has been shown to have strong dna binding activity and can detect the presence of fibrinogen in platelet fibrinogen samples. Additionally, the rpS6 antibody can be used to study cation channels and their role in cellular processes. It is available as both polyclonal and monoclonal antibodies and can be used with different types of samples including nuclear extracts.</p>Apbb1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Apbb1 antibody, catalog no. 70R-9328</p>Degré de pureté :Min. 95%CD19 antibody
<p>CD19 antibody was raised in rat using Mouse CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>PPIA Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPIA antibody, catalog no. 70R-2333</p>Degré de pureté :Min. 95%Calbindin 1 protein
<p>1-261 amino acids: MAESHLQSSL ITASQFFEIW LHFDADGSGY LEGKELQNLI QELQQARKKA GLELSPEMKT FVDQYGQRDD GKIGIVELAH VLPTEENFLL LFRCQQLKSC EEFMKTWRKY DTDHSGFIET EELKNFLKDL LEKANKTVDD TKLAEYTDLM LKLFDSNNDG KLELTEMARL LPVQENFLLK FQGIKMCGKE FNKAFELYDQ DGNGYIDENE LDALLKDLCE KNKQDLDINN ITTYKKNIMA LSDGGKLYRT DLALILCAGD N</p>Degré de pureté :>95% By Sds-PageCLPB Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLPB antibody, catalog no. 70R-3956</p>Degré de pureté :Min. 95%EGFR antibody
<p>The EGFR antibody is a highly specialized product in the field of Life Sciences. It is a histidine-rich family kinase inhibitor that specifically targets the epidermal growth factor receptor (EGFR). This antibody plays a crucial role in various biological processes, such as cell proliferation and differentiation. By binding to EGFR, it prevents the activation of downstream signaling pathways, ultimately inhibiting the growth and survival of cancer cells.</p>Degré de pureté :Min. 95%MAGEB1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEB1 antibody, catalog no. 70R-4381</p>Degré de pureté :Min. 95%α Enolase protein
<p>The alpha Enolase protein is a recombinant protein that falls under the category of Proteins and Antigens. It is derived from alpha-fetoprotein found in human serum and has various applications in the field of Life Sciences. This protein acts as a growth factor and has been shown to have neutralizing properties. It can be used in research studies involving antibodies, dopamine, liver microsomes, and colloidal substances. The alpha Enolase protein is highly versatile and can be utilized for a wide range of scientific experiments and investigations.</p>Degré de pureté :Min. 95%NKD2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NKD2 antibody, catalog no. 70R-2487</p>Degré de pureté :Min. 95%YTHDF3 antibody
<p>YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY</p>FGF acidic antibody
<p>FGF acidic antibody was raised in rabbit using highly pure recombinant human FGF-acidic as the immunogen.</p>PI4KB Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PI4KB antibody, catalog no. 70R-9392</p>Degré de pureté :Min. 95%MRTO4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MRTO4 antibody, catalog no. 70R-1198</p>Degré de pureté :Min. 95%Fibronectin antibody
<p>The Fibronectin antibody is a monoclonal antibody that specifically targets fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin plays a crucial role in cell adhesion, migration, and tissue repair. This antibody can be used for various applications, including research and diagnostic purposes.</p>IL17A protein (Mouse)
<p>Region of IL17A protein corresponding to amino acids MAAIIPQSSA CPNTEAKDFL QNVKVNLKVF NSLGAKVSSR RPSDYLNRST SPWTLHRNED PDRYPSVIWE AQCRHQRCVN AEGKLDHHMN SVLIQQEILV LKREPESCPF TFRVEKMLVG VGCTCVASIV RQAA.</p>Degré de pureté :Min. 95%Goat anti Human IgG (H + L) (Fab'2) (rhodamine)
<p>Goat anti-human IgG (H + L) (Fab'2) (rhodamine) was raised in goat using human IgG whole molecule as the immunogen.</p>Degré de pureté :Min. 95%CTACK protein
<p>Region of CTACK protein corresponding to amino acids FLLPPSTACC TQLYRKPLSD KLLRKVIQVE LQEADGDCHL QAFVLHLAQR SICIHPQNPS LSQWFEHQER KLHGTLPKLN FGMLRKMG.</p>Degré de pureté :Min. 95%β Lactoglobulin antibody
<p>The Beta Lactoglobulin antibody is a polyclonal antibody that is immobilized and used as an inhibitor of CD20 antibodies. It specifically targets the beta lactoglobulin antigen, which is a glycoprotein found in milk. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. It can be used in various applications, including research on proproteins, monoclonal antibodies, antibody-drug conjugates, cytotoxicity assays, chemokine studies, and the production of recombinant proteins. With its high specificity and affinity for the target antigen, the Beta Lactoglobulin antibody offers great potential for advancing scientific discoveries in various fields.</p>KCTD7 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD7 antibody, catalog no. 70R-5085</p>Degré de pureté :Min. 95%PPP2R5E Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R5E antibody, catalog no. 70R-9425</p>Degré de pureté :Min. 95%NXF5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NXF5 antibody, catalog no. 70R-8491</p>Degré de pureté :Min. 95%Desmoyokin antibody
<p>Desmoyokin antibody was raised in Guinea Pig using synthetic peptides of human desmoyokin coupled to KLH as the immunogen.</p>Degré de pureté :Min. 95%MAEA antibody
<p>The MAEA antibody is a polyclonal antibody that targets the MAEA protein. This antibody has been widely used in various life sciences research applications, including hybridization studies, immunoassays, and Western blotting. The MAEA antibody has shown neutralizing activity against insulin and leukemia inhibitory factor (LIF), making it a valuable tool for studying the role of these factors in cell signaling pathways. Additionally, this antibody has been used in studies investigating the effects of fatty acids, hepatocyte growth factor (HGF), epidermal growth factor (EGF), and insulin on cellular processes. The MAEA antibody is available conjugated to different labels, such as biotin or streptavidin, allowing for easy detection and visualization in experimental setups. With its versatility and high specificity, the MAEA antibody is an essential tool for researchers in the field of life sciences.</p>Capping Protein β 3 antibody
<p>Capping Protein beta 3 antibody was raised in Guinea Pig using synthetic N-terminal domain of bovine F-actin Beta 3 subunit capping protein coupled to KLH as the immunogen.</p>Degré de pureté :Min. 95%NSDHL Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NSDHL antibody, catalog no. 70R-1783</p>Degré de pureté :Min. 95%Meis3 antibody
<p>Meis3 antibody was raised in rabbit using the C terminal of Meis3 as the immunogen</p>Degré de pureté :Min. 95%CAP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CAP1 antibody, catalog no. 70R-5729</p>Degré de pureté :Min. 95%SLC1A1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC1A1 antibody, catalog no. 70R-6796</p>Degré de pureté :Min. 95%LEFTY2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LEFTY2 antibody, catalog no. 70R-6228</p>Degré de pureté :Min. 95%CD141 antibody
<p>CD141 antibody is a growth factor that targets the HER2 protein. It is a monoclonal antibody that binds specifically to HER2, inhibiting its activity and preventing the growth and proliferation of cancer cells. CD141 antibody has been used in combination with other anti-HER2 antibodies, such as trastuzumab, to enhance their efficacy in treating HER2-positive breast cancer. This antibody also has potential applications in other areas of research, including autoimmune diseases and neuroscience. With its high specificity and affinity for HER2, CD141 antibody offers a promising therapeutic option for patients with HER2-positive tumors.</p>Septin 2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SEPT2 antibody, catalog no. 70R-5632</p>Degré de pureté :Min. 95%TIFF1 protein
<p>Region of TIFF1 protein corresponding to amino acids EAQTETCTVA PRERQNCGFP GVTPSQCANK GCCFDDTVRG VPWCFYPNTI DVPPEEECEF.</p>Degré de pureté :Min. 95%LZTR1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LZTR1 antibody, catalog no. 20R-1208</p>Degré de pureté :Min. 95%UBE2I Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2I antibody, catalog no. 70R-1080</p>Degré de pureté :Min. 95%Recombinant Cat Troponin I Protein
<p>Recombinant Cat Troponin I (TNNI3) Protein is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Recombinant Cat Troponin I Protein including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Recombinant Dog Troponin I Protein
<p>Recombinant Dog Troponin I (TNNI3) Protein is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Recombinant Dog Troponin I Protein including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>HBsAg Recombinant Protein, Subtype adr
<p>HBsAg Recombinant Protein, Subtype adr is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HBsAg Recombinant Protein, Subtype adr including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Degré de pureté :Purified By Ion Exchange Chromatography. >90%Bromoacetamido-dPEG®11-Azide
<p>Bromoacetamido-dPEG®11-Azide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®11-Azide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Degré de pureté :Min. 95%Masse moléculaire :691.61 g/mol1-Decanol-d21
CAS :<p>1-Decanol-d21 is a synthetic, non-natural chemical that is used as an inhibitor of protein interactions. It has been shown to bind to the antibody and activate the receptor. This compound is also used as a research tool for studying ion channels and anti-inflammatory peptides. 1-Decanol-d21 can be used in life science research for determining the effects of ligands on receptors.</p>Formule :C10H22ODegré de pureté :Min. 95%Masse moléculaire :179.41 g/molPhthalimidooxy-dPEG®4-NHS Ester
<p>Phthalimidooxy-dPEG®4-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Phthalimidooxy-dPEG®4-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formule :C23H28N2O11Degré de pureté :Min. 95%Masse moléculaire :508.48 g/molCPN-116
<p>CPN-116 is an ion channel ligand that binds to the voltage-gated sodium channels of excitable cells. It is used for research purposes in pharmacology and cell biology. CPN-116 has been shown to activate the TRPM8 receptor, which is a ligand-gated cation channel expressed in cold sensing neurons. The purified peptide is supplied as a lyophilized powder containing at least 98% CPN-116 by weight.</p>Degré de pureté :Min. 95%Bis-dPEG®25-TFP Ester
<p>Bis-dPEG®25-TFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®25-TFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Formule :C66H106F8O29Degré de pureté :Min. 95%Masse moléculaire :1,515.52 g/molSPDP-dPEG®24-Acid
CAS :<p>SPDP-dPEG®24-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®24-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formule :C99H197N5O47Degré de pureté :Min. 95%Masse moléculaire :2,209.63 g/molAcyl 12:0 NBD pe
CAS :<p>Acyl 12:0 NBD pe is a monolayer that has been investigated in detail by confocal microscopy. It was found to deform spontaneously, which may be due to the presence of free-energy-driven spontaneous curvature and lipid bilayer instability. The deformation of the monolayers was monitored with time and it was found that they undergo cycles of deformation and relaxation. This behavior is different from what would be expected from an elastic material.</p>Formule :C39H68N5O11PDegré de pureté :Min. 95%Masse moléculaire :813.96 g/molNH2-dPEG®4-Glu(OH)-NH-dPEG®4-Glu(OH)-NH-m-dPEG®24
<p>NH2-dPEG®4-Glu(OH)-NH-dPEG®4-Glu(OH)-NH-m-dPEG®24 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>Formule :C97H185N7O48Degré de pureté :Min. 95%Masse moléculaire :2,217.52 g/molSB 269970
CAS :<p>SB 269970 is a pharmacological agent that binds to the 5-HT2 receptor. This drug has been shown to inhibit the proliferation of tumor cells in a mouse model and to reduce the release of 5-HT from trigeminal nerve endings. SB 269970 inhibits 5-HT2 receptors and blocks their activity. It also inhibits the synthesis of 5-HT, which is mediated by protein kinase C (PKC). SB 269970 has been shown to be an antagonist of growth factor β1 and can be used for the treatment of depression. This drug also has effects on microdialysis probes in rats, inhibiting 5-ht concentrations in whole cell recordings.</p>Formule :C18H28N2O3SDegré de pureté :Min. 95%Masse moléculaire :352.49 g/molBiotin-dPEG®23-Lipoamide
<p>Biotin-dPEG®23-Lipoamide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®23-Lipoamide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formule :C66H126N4O26S3Degré de pureté :Min. 95%Masse moléculaire :1,487.92 g/molNeuromedin S (Mouse)
<p>Neuromedin S (Mouse) is a research tool that belongs to the ligand and receptor category. It has an activation function, which is classified as a type of receptor. In cell biology, neuromedin S is involved in the regulation of ion channels and protein interactions. Neuromedin S is also involved in the regulation of high-purity materials for pharmacology and life science. This product may be used as an inhibitor.</p>Degré de pureté :Min. 95%DOTA-tris(Acid)-Amido-dPEG®24-Amido-dPEG®24-DSPE
<p>DOTA-tris(Acid)-Amido-dPEG®24-Amido-dPEG®24-DSPE is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(Acid)-Amido-dPEG®24-Amido-dPEG®24-DSPE is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Degré de pureté :Min. 95%Masse moléculaire :3,391.14 g/molm-dPEG®8-Azide (Azido-m-dPEG®8)
<p>m-dPEG®8-Azide (Azido-m-dPEG®8) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-Azide (Azido-m-dPEG®8) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formule :C20H20F4N2O7Degré de pureté :Min. 95%Masse moléculaire :476.38 g/molGHRF, mouse
<p>Please enquire for more information about GHRF, mouse including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formule :C220H365N69O64SDegré de pureté :Min. 95%Masse moléculaire :5,032.74 g/molKD20 peptide
<p>KD20 peptide is a lysine-aspartic acid peptide with 20 repeating units. KD20 peptide is used to stimulate CD4+ T cells in vitro and KD20 actions result in protection against abscesses induced by bacteria.</p>SARS-CoV-2 Spike RBD 513-520 peptide
<p>SARS-CoV-2 Spike RBD 513-520 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). SARS-CoV-2 Spike RBD 513-520 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.<br>SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 513-520 (Biotin-LC) peptide</p>SARS-CoV-2 Spike RBD 523-541 peptide
<p>SARS-CoV-2 Spike RBD 523-541 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). SARS-CoV-2 Spike RBD 523-541 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.<br>SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 523-541 (Biotin-LC) peptide</p>Spike S protein library
<p>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.</p>NY-ESO-1 (123-137) DRB1*04:01
<p>NY-ESO-1 protein:<br>NY-ESO-1 (123-137) DRB1*04:01 is an epitope analogue of the New York esophageal squamous cell carcinoma-1, also named cancer testis. NY-ESO-1 is expressed in 82% of neuroblastomas and 46% of melanomas but also in many others solid tumors and hematological malignancies. That’s why, NY-ESO-1 peptides are attractive targets for specific immunotherapies and for the stimulation of human NY-ESO-1 specific CD8+ T cells.<br>Applications of NY-ESO-1 (123-137) DRB1*04:01:<br>Results of studies suggest after stimulation of NY-ESO-1 (123-137) DRB1*04:01 specific T cells and IFN- ELISPOT and chronium release assays that NY-ESO-1 (123-137) DRB1*04:01 can be an immunogenic epitope encoded by NY-ESO-1. NY-ESO-1 (123-137) DRB1*04:01 contains epitope capable of binding HLA-DR molecules.</p>SARS-CoV-2 Spike RBD 371-394 peptide
<p>SARS-CoV-2 Spike RBD 371-394 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). SARS-CoV-2 Spike RBD 371-394 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.<br>SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 371-394 (Biotin-LC) peptide</p>OVA 257-264 scrambled
<p>SB-peptide offers the scrambled version of OVA 257-264. FILKSINE can be used as a negative control of OVA 257-264 studies.<br>SB-peptide offers also OVA 257-264 (see section OVA 257-264).<br>Ovalbumin protein:<br>OVA 257-264 (H-2Kb) is an epitope of interest of the egg white albumen, ovalbumin. Ovalbumin is a glycoprotein that is sufficiently large and complex to be mildly immunogenic. Indeed, it has been demonstrated that Ovalbumin contains B-cell epitopes which are recognized by specific IgE antibodies and CD4 T cell epitopes restricted by the MHC I-Ad molecule in mice and by HLA-D molecule in human.<br>Applications of OVA 257-264:<br>OVA 257-264 is used to stimulate T cells in PBMCs and to quantify peptide epitope specificity and IFN-γ releasing effector cells by ELISPOT assay. OVA 257-264 is also used to test new adjuvant in immunotherapeutic vaccine development. OVA 257-264 can form a stable hydrogel and stimulate a immune response. This reaction seems to be linked with OVA 257-264 property to self-assemble into a hydrogel.<br>Sequence:C45H74N10013</p>TAT (47-57) peptide
<p>AT (47-57) peptide, also known as HIV-1 TAT protein, is the most characterized fragment of the HIV transactivator protein (TAT). TAT (47-57) peptide was show to be a cell-penetrating peptide (CPP). TAT (47-57) is an arginine-rich peptide which directly penetrates plasma membrane and stabilized DNA. TAT (47-57) has the ability to translocate the plasma membrane and facilitate the delivery of various cargoes such as protein, peptide, antibodies, and liposomes. It represents an important tool to increase the biodistribution of drugs.</p>Biotin-SARS-CoV-2 Spike RBD 513-520 peptide
<p>Biotin-SARS-CoV-2 Spike RBD 513-520 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 513-520 peptide. SARS-CoV-2 Spike RBD 513-520 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 513-520 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.</p>ovalbumine 154-159
<p>Ovalbumin 154-159, also nammed TNGIIR peptide, is a portion of interest of the egg white albumen.</p>ω-Hexatoxin-Hv1a
<p>Blocker of mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca(v)) currents</p>Biotin-SARS-CoV-2 Spike RBD 319-335 peptide
<p>Biotin-SARS-CoV-2 Spike RBD 319-335 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 319-335 peptide. SARS-CoV-2 Spike RBD 319-335 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 319-335 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.</p>Biotin-SARS-CoV-2 Spike RBD 395-430 peptide
<p>Biotin-SARS-CoV-2 Spike RBD 395-430 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 395-430 peptide. SARS-CoV-2 Spike RBD 395-430 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 395-430 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.</p>NYLAWYQQKPGK* - SIL Adalimumab signature peptide quantifier
<p>SIL peptide for Adalimumab detection and quantification</p>Heavy calcitonin peptide
<p>Heavy calcitonin peptide – Stable Isotope PeptideHuman Calcitonin (hCT) is a 32-amino acid hormone peptide belonging to the Calcitonin/Calcitonin-gene related peptide (CGRP) family, that also comprises amylin, adrenomedullin (AM) and adrenomedullin2/intermedin (AM2/IMD). Calcitonin is characterized by a N-terminal disulfide bond that forms a 7 amino acid ring structure, a region with a α-helix tendency and an amidated C-terminus1.Calcitonin peptide is produced by C cells of the thyroid gland and binds preferentially to the G-protein coupled receptor, calcitonin receptor (CTR)1. Calcitonin receptor signals through activated Gs protein and the production of cAMP second messenger molecules by adenylyl cyclase1. The dissociation constant (Kd) of calcitonin receptors expressed by a human ovarian small cell carcinoma line is approximately 4.6 nM for human Calcitonin2.Calcitonin is involved in the homeostasis of calcium and phosphorus, and the regulation of bone dynamics. At the basal state, calcitonin secretion reduces plasma calcium and phosphorus levels, and promote bone formation. In Calca -/- mice, a murin particle-induced osteolysis model, Calcitonin peptide has been used as a test compound for studying the effects of calcitonin deficiency. It has been shown that artificial calcitonin subsitution inhibits bone resorption by reducing the formation of osteoclasts and thereby the resulting osteolytic reaction3. The Hypocalcemic Human calcitonin was also used as a positive control to monitor changes in serum calcium levels in HHD transgenic mice vaccinated with Parathyroid hormone-related protein (PTH-rP)-derived peptides in the context of anti-cancer immunotherapy study4. Moreover, it has been reported that calcitonin peptide is a potent stimulator of uncapacitated mouse spermatozoa by regulating a specific isoform of adenylyl cyclase and the production of cAMP, which plays a pivotal role in mammalian sperm function5.sb-PEPTIDE provides stable isotope labeled calcitonin peptide. This peptide has been quantified accurately using amino acid analysis.</p>AZDye 568 TCO
<p>Reacts with tetrazines to produce a stable, covalent linkage, also referred to as the inverse-electron demand Diels-Alder cycloaddition reaction. This reaction is extremely fast (k > 800 M -1 s-1), selective, biocompatible, and does not require Cu-catalyst or elevated temperatures.</p>Formule :C47H51NN4S3O12Biotin-MAGE-A1 (278-286)
<p>Biotin-MAGE-A1 (278-286) is the N-ter biotinylated version of MAGE-A1 (278-286). Biotin-MAGE-A1 (278-286) can be used in the analysis of antigen-specific T cells. MAGE-A1 protein:<br>MAGE-A1 (278-286) is an epitope of Melanoma Antigen Gene A1 expressed by tumors of different histological types such as on the surface of breast carcinoma cell and is a Cancer/Testis Antigens (CTA). MAGE-A1 is a tumor antigen expressed in 40% of melanoma and contains epitope for binding HLA-A*02:01 molecules and that are recognized by cytotoxic T cells.<br>Applications of MAGE-A1 (278-286):<br>MAGE-A1 (278-286) is used to stimulate specific cytotoxic T cells in PBMCs and to analyze by ELISPOT peptide epitope specificity and cytokine production like IFN-γ. Immunogenicity of MAGE-A1 (278-286) raised the possibility of developing anticancer immunotherapies or vaccinations. MAGE-A1 is also expressed in lung adenocarcinoma and studies suggest that MAGE-A1 may serve to develop Chimeric Antigen Receptor (CAR) T cell therapy using lentiviral vector and show an encouraging tumor-inhibitory efficacy.<br>Sequence: Biotin-KVLEYVIKV</p>
