Produits biochimiques et réactifs

<p>The GFP Antibody is a cytotoxic monoclonal antibody that targets the protein complex involved in various cellular processes. It specifically binds to the mineralocorticoid receptor, which plays a crucial role in regulating electrolyte balance and blood pressure. Additionally, this antibody has been shown to inhibit the production of interleukin-6, a pro-inflammatory cytokine, and dopamine, a neurotransmitter involved in mood regulation. The GFP Antibody also interacts with nuclear receptors and modulates their activity, thereby affecting gene expression. This product has high viscosity due to its glycosylation pattern and can be used in various applications within the Life Sciences field. Notably, it has been studied in conjunction with haloperidol, teriparatide, and ornithine for its potential therapeutic benefits.</p>

<p>Purified Polyclonal Kv7.1 antibody</p>

<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 23-29 of cTnI as the immunogen.</p>

<p>The Influenza A protein is a key component in the field of Life Sciences. It plays a crucial role in various biological processes, including the regulation of TGF-beta and caspase-9. This protein is also involved in the formation of amyloid plaques, which are associated with certain neurodegenerative diseases.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CBX3 antibody, catalog no. 20R-1095</p>

<p>TKTL2 antibody was raised using the N terminal of TKTL2 corresponding to a region with amino acids QLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRGHAAPILYAAW</p>

<p>HNRPK antibody was raised using the N terminal of HNRPK corresponding to a region with amino acids NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKG</p>

<p>The SH2B3 antibody is a monoclonal antibody that specifically targets the SH2B3 protein. This protein plays a crucial role in regulating various biological processes, including growth factor signaling, iron homeostasis, and cytoskeletal structure. The SH2B3 antibody has been extensively tested and validated for its specificity and effectiveness in detecting the SH2B3 protein in human serum samples.</p>

<p>Purified recombinant B9D2 protein (His tag)</p>

<p>IL6 antibody was raised in rabbit using highly pure recombinant hIL-6 as the immunogen.</p>

<p>Purified recombinant Human HBG2 protein (His tag)</p>

<p>ARID5A antibody was raised in rabbit using the N terminal of ARID5A as the immunogen</p>

<p>Influenza A antibody (H1N1) was raised in goat using influenza A, strain USSR (H1N1) as the immunogen.</p>

<p>Rabbit polyclonal Cyclosome 1 antibody</p>

<p>Rabbit polyclonal ZNF133 antibody</p>

<p>Mouse monoclonal FERMT2 antibody</p>

<p>The p300 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to the p300 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied for its cytotoxic effects on cancer cells and its potential as an anti-VEGF (vascular endothelial growth factor) therapy.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of hCG_1646157 antibody, catalog no. 70R-9035</p>

<p>Mouse monoclonal 41BB antibody (PE)</p>

<p>The SQSTM1 antibody is a monoclonal antibody that is highly effective in neutralizing the protein SQSTM1. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to inhibit the activation of SQSTM1, which plays a crucial role in several cellular processes. The SQSTM1 antibody can be used for research purposes, such as studying the effects of SQSTM1 on cell growth and differentiation. Additionally, it has shown potential therapeutic benefits in targeting specific diseases associated with abnormal SQSTM1 activity, including certain types of cancer and neurodegenerative disorders. With its high specificity and low density, this monoclonal antibody offers great potential in biomaterials and drug development.</p>

<p>LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL</p>

<p>ATC0175 is a synthetic analog of the natural fatty acid, gamma-aminobutyric acid (GABA). It has been shown to bind to GABA receptors in the brain and has potent antagonistic activity. ATC0175 inhibits serotonergic system and may be effective as a treatment for metabolic disorders, such as insulin resistance. In addition, this chemical compound may be beneficial for skin conditions such as psoriasis or eczema. ATC0175 is also synergistic with insulin in reducing food intake and body weight.</p>

<p>Purified Polyclonal GSK3 alpha/beta antibody</p>

<p>Rabbit Polyclonal IRS1 antibody (Ser636)</p>

<p>HGH protein containing 192 amino acids.</p>

<p>UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD</p>

<p>The PDCD6IP antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to the PDCD6IP protein, also known as Programmed Cell Death 6 Interacting Protein. This protein plays a crucial role in various cellular processes, including cell death regulation and signal transduction.</p>

<p>Rabbit polyclonal Opioid Receptor theta antibody (Ser363)</p>

<p>ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK</p>

<p>The SRR antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It has been extensively used in research studies to investigate the role of ketanserin, an antagonist of serotonin receptors, as well as other growth factors and angiogenic factors. The SRR antibody has been widely employed in agglutination assays to study the interaction between different molecules such as superoxide, dopamine, fibrinogen, collagen, and erythropoietin. Additionally, it has been utilized in experiments involving phalloidin staining and endothelial growth assays. With its high specificity and reliability, the SRR antibody is an invaluable tool for scientists working in diverse areas of biological research.</p>

<p>Rabbit polyclonal TIP60 antibody (Ser86)</p>

<p>Purified Polyclonal APBA2 antibody</p>

<p>The TMEM27 antibody is a highly versatile and potent medicament that plays a crucial role in various biological processes. This polyclonal antibody specifically targets the transmembrane protein 27 (TMEM27), which is involved in numerous cellular functions.</p>

<p>Rabbit polyclonal SPHK2 antibody</p>

<p>ITAC antibody was raised in rabbit using highly pure recombinant human I-TAC as the immunogen.</p>

<p>KIAA1324 antibody was raised using the N terminal of KIAA1324 corresponding to a region with amino acids PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW</p>

<p>RBM34 antibody was raised using the C terminal of RBM34 corresponding to a region with amino acids SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK</p>

<p>Rhotekin antibody was raised using the N terminal of RTKN corresponding to a region with amino acids DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG</p>

<p>The Salbutamol antibody is a highly specialized polyclonal antibody that targets the phosphatase growth factor-1 receptor. It is commonly used in life sciences research to study the effects of TGF-beta, collagen, and other growth factors. This antibody has been proven to have neutralizing properties, effectively blocking the activity of these growth factors and allowing researchers to better understand their role in various biological processes.</p>

<p>UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL</p>

<p>The CSPG5 antibody is a highly specialized monoclonal antibody that targets collagen, a key component of human serum and various biomolecules. This antibody is widely used in the field of Life Sciences for research purposes. It can be employed in various applications such as immobilization on electrodes, detection of glutamate levels, and analysis of pleural fluid. Additionally, the CSPG5 antibody has demonstrated cytotoxic and inhibitory effects on growth factors, making it a valuable tool for studying cellular processes and signaling pathways. With its high specificity and versatility, this antibody is an essential resource for scientists and researchers in the field.</p>

<p>Rabbit polyclonal SPIRE1 antibody</p>

<p>HSFY2 antibody was raised in rabbit using the C terminal of HSFY2 as the immunogen</p>

<p>The CYP1A2 antibody is a highly specialized product used in Life Sciences research. It is designed to target and detect messenger RNA (mRNA) expression levels of the CYP1A2 gene. This antibody has been extensively tested and validated using rat liver microsomes, as well as human liver microsomal and hepatocyte samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPSB2 antibody, catalog no. 70R-10123</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR6C75 antibody, catalog no. 70R-6259</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication. It has been extensively studied using advanced techniques such as patch-clamp on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Rabbit polyclonal RPA4 antibody</p>

<p>The SRR antibody is a highly specific monoclonal antibody that targets the serine protease SRR. This antibody is widely used in various assays and research studies in the field of Life Sciences. It has been proven to effectively inhibit the activity of SRR, leading to lysis of targeted cells. The SRR antibody is commonly used in drug development as an erbb2 inhibitor and has shown promising results in preclinical studies. Additionally, this antibody has been used in research involving interleukin signaling pathways and phosphatase regulation. Its high affinity and specificity make it an ideal tool for studying the role of SRR in various biological processes. The SRR antibody is available for purchase and can be used in both in vitro and in vivo experiments using human serum or human hepatocytes.</p>

<p>The USP22 antibody is a highly specialized product in the field of Life Sciences. It is an acidic glycosylation agent that is commonly used in research related to insulin, adipose tissue, and interferon. This antibody plays a crucial role in studying the function of adipocytes and their impact on various physiological processes. It has been shown to modulate e-cadherin expression, which is important for cell adhesion and tissue integrity.</p>

<p>The CD54 antibody is a monoclonal antibody that targets the CD54 protein, also known as intercellular adhesion molecule-1 (ICAM-1). It is commonly used in life sciences research to study cell growth and signaling pathways. The CD54 antibody binds specifically to the CD54 protein, which plays a crucial role in cell adhesion and immune response. By blocking the interaction between CD54 and its ligands, this antibody can inhibit various cellular processes such as inflammation and tumor progression. Additionally, the CD54 antibody has been used in studies investigating the effects of growth factors, steroids, dopamine, and kinase inhibitors on cell behavior. Its versatility makes it an essential tool for researchers in various fields of study within the life sciences.</p>

<p>Rabbit polyclonal SRGAP3 antibody</p>

<p>Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>TMEM106C antibody was raised using the middle region of TMEM106C corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG</p>

<p>Perilipin antibody was raised in guinea pig using duplicated N-terminus of perilipin as the immunogen.</p>

<p>Purified recombinant PSG1 protein (His tag)</p>

<p>EGFR antibody (AF488) was raised in mouse using human A431 membrane proteins as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal beta Adaptin antibody</p>

<p>LAT antibody is an antigen that specifically targets the oncostatin M receptor (OSMR) and inhibits its activity. OSMR is a transmembrane receptor that is expressed on various cell types, including liver microsomes. LAT antibody has been shown to block the interaction between OSMR and its ligand, oncostatin M, thereby preventing downstream signaling events. This antibody has also been demonstrated to inhibit the activation of β-catenin, a key component of the Wnt signaling pathway. In addition to its role in cancer research, LAT antibody is widely used in life sciences for immunohistochemistry and western blotting applications. It is available as both polyclonal and monoclonal antibodies and can be used in combination with other inhibitors or tyrosine kinase inhibitors for more comprehensive studies.</p>

<p>Purified recombinant GEMIN6 protein (His tag)</p>

<p>Karyopherin Alpha 6 antibody was raised using a synthetic peptide corresponding to a region with amino acids STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP</p>

<p>Florfenicol Amine antibody is a powerful tool for detecting and studying the expression of forskolin in various samples. It is a polyclonal antibody that specifically binds to forskolin, a potent activator of adenylate cyclase. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MSH2 antibody, catalog no. 70R-5689</p>

<p>IFITM5 antibody was raised in rabbit using the middle region of IFITM5 as the immunogen</p>

<p>Rabbit polyclonal NSF antibody (FITC)</p>

<p>Rabbit polyclonal CYP2W1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EEF2 antibody, catalog no. 70R-2318</p>

<p>IKK-gamma antibody was raised in rabbit using residues 2-13 [NRHLWKSQLCEM] of the IKK-gamma protein as the immunogen.</p>

<p>The 53BP1 antibody is a monoclonal antibody that specifically targets protein tyrosine kinases and interferon. It is a potent inducer of apoptosis, making it an effective tool for studying cell death pathways in various research fields, particularly in Life Sciences. This antibody has been extensively tested and validated for its high specificity and sensitivity in detecting 53BP1 protein expression.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACOT9 antibody, catalog no. 70R-10191</p>

<p>Rabbit anti-canine IgG (H + L) (FITC) was raised in rabbit using canine IgG (H &amp; L) as the immunogen.</p>

<p>Dopamine (D2) receptor antagonist</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Delta-Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH trifluoroacetate salt is a peptide that has been shown to have a hypnotic effect in mice. It was found to increase the time spent on the rotarod and decrease locomotor activity in mice. This drug has also been shown to be hypoglycemic and to modulate transcriptional regulation of fatty acid metabolism. Delta Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly Gly Glu OH trifluoroacetate salt may be useful in treating autoimmune diseases, such as multiple sclerosis, due to its ability to regulate 5HT concentrations.</p>

<p>Methotrexate is a drug that suppresses the immune system by inhibiting the production of white blood cells. It is used in the treatment of a number of diseases, including some cancers and autoimmune diseases such as rheumatoid arthritis and psoriasis. Methotrexate is metabolized to its active form, methotrexate, by an enzyme called dihydrofolate reductase (DHFR). The DHFR inhibitor activity of methotrexate blocks the synthesis of folate-dependent enzymes and prevents DNA synthesis in rapidly dividing cells. Methotrexate has been used in combination with other drugs to treat cancer. Methotrexate has also been shown to have antifungal properties against opportunistic fungal infections.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Lariciresinol is a natural compound that has been shown to have antioxidative properties and inhibit the growth of cancer cells in vitro. It has also been shown to reduce the metastatic potential of colorectal cancer cells by inhibiting fatty acid synthesis. Lariciresinol has synergistic effects when combined with other natural compounds, such as resveratrol, for example. This compound inhibits the proliferation of cancer cells by inducing apoptosis through a multivariate logistic regression analysis. The mechanism of lariciresinol-mediated apoptosis includes inhibition of transcriptional regulation and mitochondrial membrane potential, which leads to an increase in reactive oxygen species (ROS) and reactive nitrogen species (RNS). Lariciresinol also inhibits bacterial growth by binding to DNA gyrase and topoisomerase IV and interfering with transcription through RNA polymerase.</p>

<p>Please enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about FITC-beta-Ala-Amyloid beta-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Orexin A trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Z-His-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Fmoc-Phe-Pro-OH is a sensor molecule that has been used in supramolecular, nanostructured, and biological applications. It is a supramolecular self-assembly process that can be applied to sensors, devices, and modules. Fmoc-Phe-Pro-OH can be used as a biological source for sensing bacteria or other molecules of interest. The structural properties of Fmoc-Phe-Pro-OH have been studied extensively and it has been found to have favorable properties for use in humans. Advances in this field are ongoing with the hope of improving the understanding of biological systems and human health.</p>

<p>Glucagon-like peptide 1 (GLP-1) receptor agonist</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>E3 Ligase Ligand 1a is a small molecule ligand, which is typically synthesized in a laboratory setting. The ligand acts as a recruiter for E3 ubiquitin ligases, proteins that play a pivotal role in the ubiquitin-proteasome pathway. By binding to an E3 ligase, the ligand can facilitate the ubiquitination and subsequent degradation of target proteins. This mechanism is central to modulating protein levels within a cell, enabling researchers to study protein function and regulation dynamically.</p>

<p>BAY-069 is a small-molecule inhibitor, derived through advanced chemical synthesis, designed to selectively target critical molecular pathways in cancer cells. The compound is synthesized using a series of intricate organic reactions that ensure its specificity and potency. Its mode of action involves binding to and inhibiting the activity of key enzymes involved in the regulation of the cell cycle, thereby disrupting the proliferative capacity of malignant cells.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone is an apoptosis inducer that belongs to the category of small molecules. It has been shown to induce apoptosis in cells by binding to DNA and inhibiting transcription, leading to DNA fragmentation and the activation of caspase-8. Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone has also been shown to have a synergistic effect on cells when combined with other potent inducers of apoptosis. This drug binds to toll receptors (TLR) and IL2 receptors, which are important for cell signaling pathways.</p>

<p>Please enquire for more information about Z-Thr(Bzl)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide hormone that is produced in the body and has various physiological effects, such as vasodilation, bronchoconstriction, and the release of histamine from mast cells. Bradykinin is also used in pharmacological treatments for malignant brain tumors, congestive heart failure, and epidermal growth factor-responsive dermatoses. Bradykinin can be administered intravenously or subcutaneously to treat these conditions. The drug can also be administered intraperitoneally to treat high blood pressure during pregnancy. Bradykinin is an ester of 3-b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9-OH with trifluoroacetic acid. It is synthesized by linking two molecules together through an ester bond. This drug has many beneficial effects on the human body due to its ability to inhibit enzymes that are involved in the production of prostagland</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Somatostatin is a polypeptide hormone that is produced by the body to inhibit the release of other hormones in the body. It has also been used to treat diseases such as carcinoid syndrome, intestinal disorders, and diabetes mellitus type I. Somatostatin binds to somatostatin receptors on cells, which leads to inhibition of cell growth and secretion of hormones. Somatostatin has been shown to block basic protein synthesis and energy metabolism in rat liver cells. Its receptor activity is mediated by binding with signal peptide sequences and response elements.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>2-(4-Chlorophenyl)-5-cyclohexyl-1,3,4-oxadiazole is a ligand that is used as an activator in cell biology. It binds to the receptor and causes ion channels to open, which leads to depolarization of the cell membrane. 2-(4-Chlorophenyl)-5-cyclohexyl-1,3,4-oxadiazole is also used as a research tool for studying protein interactions and pharmacology. This compound has been shown to be an inhibitor of peptide bond formation in the synthesis of proteins and may also inhibit DNA replication.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>KUNB31 is a synthetic enzyme inhibitor, which is an engineered compound designed to interfere with the activity of specific enzymes in various biochemical pathways. This product is synthesized through a series of complex chemical reactions, ensuring high specificity and activity against target enzymes. Its mode of action involves binding to the active sites of enzymes, thereby preventing substrates from interacting and altering enzymatic activity.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-D-Asp(OMpe)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Angiotensin I human acetate salt hydrate is a synthetic peptide, which is a derivative of the human angiotensinogen protein. It is sourced through chemical synthesis methods that replicate the natural sequence of this protein's active fragment. The mode of action involves conversion by the enzyme angiotensin-converting enzyme (ACE) into angiotensin II, a potent vasoconstrictor, which plays a critical role in blood pressure regulation and fluid balance.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-Gly-Glu-Gly-OH trifluoroacetic acid is a dilute buffer solution of amino acids. It has been used to study the thermodynamic stability of polypeptides and their sensitivity to acidic conditions. Experiments have shown that H-Gly-Glu-Gly-OH trifluoroacetic acid is more stable than glycine, glutamic acid, histidine, aspartic acid, or aspartyl. This compound is an amino acid with a high concentration of glutamic acid.</p>

<p>H-D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2 is a neuropeptide that was found in the brain of an amphibian and has been shown to have antinociceptive properties. The peptide has been shown to bind to kappa opioid receptors and δ opioid receptors, which are both involved in pain regulation. H-D-Phe-Cys-Tyr-D-Trp-Orn (HDFYDT) has been shown to be effective in vivo, which may be due to its ability to increase striatal dopamine levels and decrease locomotor activity. HDFYDT also increases gamma aminobutyric acid levels in the brain, which may result in reduced anxiety. HDFYDT is synthesized from two amino acids: histidine and glutamine. This peptide is sensitive to proteolytic enzymes and can be degraded into smaller fragments such</p>

<p>Cl4H6 is a medicinal compound that has shown promising results in inhibiting kinases, which are enzymes involved in the growth and proliferation of cancer cells. This anticancer agent has been tested on human tumor cell lines and has demonstrated its ability to induce apoptosis or programmed cell death in these cells. Cl4H6 is a potent inhibitor of protein kinases and may have potential therapeutic applications for cancer treatment. It is also an analog of Chinese herbal medicine compounds found in urine samples with similar anticancer properties. The use of Cl4H6 as a kinase inhibitor holds great promise for the development of novel cancer therapies.</p>