Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(99.115 produits)
- Par Biological Target(99.160 produits)
- Par usage/effets pharmacologiques(6.787 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(346 produits)
- Biologie végétale(6.722 produits)
- Métabolites secondaires(14.222 produits)
130582 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Sheep IgG ELISA Kit
<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>Degré de pureté :Min. 95%Human Prealbumin ELISA Kit
<p>Please enquire for more information about Human Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human B2M ELISA Kit
<p>Human Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Degré de pureté :Min. 95%Mouse SAP ELISA Kit
<p>Please enquire for more information about Mouse SAP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Degré de pureté :Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Degré de pureté :Min. 95%Dog CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>Degré de pureté :Min. 95%Human Osteopontin ELISA Kit
<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>Degré de pureté :Min. 95%Mouse IgG3 ELISA Kit
<p>Please enquire for more information about Mouse IgG3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse Retinol Binding Protein ELISA Kit
<p>Mouse Retinol Binding Protein ELISA Kit</p>Degré de pureté :Min. 95%Human Apolipoprotein A1 ELISA Kit
<p>Please enquire for more information about Human Apolipoprotein A1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat CRP ELISA Kit
<p>Please enquire for more information about Rat CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Troponin1, His tagged human
CAS :<p>Troponin1 is a protein that is found in the muscle cells of humans. Troponin1 binds to actin, tropomyosin, and troponin C, which are proteins that make up the thin filament of the sarcomere. Tropomyosin blocks actin binding sites on the thin filament and prevents cross-bridge formation. When tropomyosin is displaced by troponins, it exposes these sites for interaction with myosin heads, which form cross-bridges with actin. Troponins also regulate calcium release from the sarcoplasmic reticulum during excitation-contraction coupling. The human troponins are encoded by different genes and are identified as TNN1 (Troponin 1), TNN2 (Troponin 2), TNN3 (Troponin 3), or TNN4 (Troponin 4). This antibody reacts with human cardiac and skeletal muscle tropomyosins and not</p>Degré de pureté :Min. 95%Sodium pyrophosphate decahydrate
CAS :<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>Formule :H4O7P2•Na4•(H2O)10Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :450.09 g/molMouse CRP ELISA Kit
<p>Please enquire for more information about Mouse CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse IgG1 ELISA Kit
<p>Please enquire for more information about Mouse IgG1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Bovine Haptoglobin ELISA Kit
<p>Please enquire for more information about Bovine Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Ceruloplasmin ELISA Kit
<p>Human Ceruloplasmin ELISA kit is intended for the quantitative determination of total human ceruloplasmin in biological samples.</p>Degré de pureté :Min. 95%anti-TGEV Antibody
<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>Degré de pureté :Min. 95%Monkey Hemoglobin ELISA Kit
<p>Hemoglobin is a protein found in red blood cells that is responsible for carrying oxygen from the lungs to the rest of the body and transporting carbon dioxide from the body back to the lungs. It is a crucial component of the blood, contributing to its red color. Hemoglobin contains iron, which binds to oxygen and gives blood its ability to transport oxygen throughout the body. This process is essential for cellular respiration and energy production in the body.</p>Degré de pureté :Min. 95%D-Threonic acid lithium salt
CAS :<p>D-Threonic acid lithium salt is a cell signaling molecule that belongs to the class of ligands. It has been used as a research tool in pharmacology and protein interaction studies. D-Threonic acid lithium salt can activate ion channels, which are cellular membrane proteins that allow ions to flow in or out of cells. D-Threonic acid lithium salt also interacts with receptors, which are proteins on the surface of cells that receive chemical signals from outside the cells. Receptors can be either agonists or antagonists. D-Threonic acid lithium salt is a ligand for receptor tyrosine kinase, which is involved in cell growth and differentiation.</p>Formule :C4H8O5·LiDegré de pureté :Min. 95%Monkey IgM ELISA Kit
<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>Degré de pureté :Min. 95%Canine MMP1 ELISA kit
<p>ELISA Kit for detection of MMP1 in the research laboratory</p>Degré de pureté :Min. 95%Bestatin-amido-Me
CAS :<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>Formule :C17H27N3O3Degré de pureté :Min. 95%Masse moléculaire :321.4 g/molCA 19-9 ELISA kit
<p>ELISA kit for the detection of CA 199 in the research laboratory</p>Degré de pureté :Min. 95%Porcine IL17 ELISA kit
<p>ELISA Kit for detection of IL17 in the research laboratory</p>Degré de pureté :Min. 95%PR3 ELISA kit
<p>ELISA kit for the detection of PR3 in the research laboratory</p>Degré de pureté :Min. 95%HEPES, Hemisodium Salt
CAS :<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>Formule :C8H18N2O4S•Na0Degré de pureté :Min. 95%Masse moléculaire :249.3 g/molHuman Mullerian hormone ELISA kit
<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>Degré de pureté :Min. 95%Human IL18 ELISA Kit
<p>ELISA kit for detection of IL18 in the research laboratory</p>Degré de pureté :Min. 95%ENA ELISA kit
<p>ELISA kit for the detection of ENA in the research laboratory</p>Degré de pureté :Min. 95%Histamine ELISA Kit
<p>Histamine ELISA Kit for the quantitative determination of Histamine in plasma and urine</p>Degré de pureté :Min. 95%Serotonin ELISA Kit
<p>ELISA kit for detection of Serotonin in the research laboratory</p>Degré de pureté :Min. 95%ssDNA ELISA kit
<p>ELISA kit for the detection of ssDNA in the research laboratory</p>Degré de pureté :Min. 95%Mouse OPG ELISA kit
<p>ELISA kit for the detection of OPG in the research laboratory</p>Degré de pureté :Min. 95%Human A2M ELISA Kit
<p>Please enquire for more information about Human A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human SAA ELISA Kit
<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human VEGFR2 ELISA Kit
<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>Degré de pureté :Min. 95%Affinity Purified anti-Human Ferritin Antibody
<p>Affinity Purified Rabbit anti-Human Ferritin Antibody</p>Degré de pureté :Min. 95%Human IgA ELISA Kit
<p>Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Rat IgG ELISA kit
<p>ELISA Kit for detection of IgG in the research laboratory</p>Degré de pureté :Min. 95%Mouse Leptin Receptor ELISA kit
<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>Degré de pureté :Min. 95%Human PGF2a ELISA kit
<p>ELISA Kit for detection of PGF2a in the research laboratory</p>Degré de pureté :Min. 95%Human Retinol Binding Protein ELISA Kit
<p>Please enquire for more information about Human Retinol Binding Protein ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%CMV ELISA Kit
<p>ELISA kit for detection of CMV in the research laboratory</p>Degré de pureté :Min. 95%Human IL1 β ELISA kit
<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>Degré de pureté :Min. 95%Rat TrkA ELISA Kit
<p>ELISA kit for detection of TrkA in the research laboratory</p>Degré de pureté :Min. 95%Rubella ELISA Kit
<p>ELISA kit for detection of Rubella in the research laboratory</p>Degré de pureté :Min. 95%TPTE antibody
<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>Human BDNF ELISA Kit
<p>ELISA kit for detection of BDNF in the research laboratory</p>Degré de pureté :Min. 95%Phospholipid Screen IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%H-MEVGWYRPPFSRVVHLYRNGK-OH
<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>MEF2A antibody
<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>Degré de pureté :Min. 95%Human PDGFAB ELISA Kit
<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>Degré de pureté :Min. 95%Mouse Free Thyroxine ELISA kit
<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>Degré de pureté :Min. 95%Mouse IgG2A ELISA Kit
<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Donkey anti Chicken IgY (H + L) (HRP)
<p>Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H & L) as the immunogen.</p>Endothelin A Receptor antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>TAPI-2
CAS :<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>Formule :C19H37N5O5Degré de pureté :Min. 95%Masse moléculaire :415.53 g/molHuman Growth Hormone ELISA Kit
<p>ELISA kit for detection of Growth Hormone in the research laboratory</p>Degré de pureté :Min. 95%Triiodothyronine ELISA Kit
<p>ELISA kit for detection of Triiodothyronine in the research laboratory</p>Degré de pureté :Min. 95%Rat Triiodothyronine ELISA kit
<p>ELISA Kit for detection of Triiodothyronine in the research laboratory</p>Degré de pureté :Min. 95%Mouse PGD2 ELISA kit
<p>ELISA Kit for detection of PGD2 in the research laboratory</p>Degré de pureté :Min. 95%Dopamine ELISA kit
<p>ELISA kit for the detection of Dopamine in the research laboratory</p>Degré de pureté :Min. 95%Chlamydia Pneumoniae IgA ELISA kit
<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>Degré de pureté :Min. 95%HRP-IgG Conjugation Kit
<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>Degré de pureté :Min. 95%Chicken IL17 ELISA kit
<p>ELISA Kit for detection of IL17 in the research laboratory</p>Degré de pureté :Min. 95%Rat IgG ELISA Kit
<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human Haptoglobin ELISA Kit
<p>Please enquire for more information about Human Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Mouse MMP2 ELISA kit
<p>ELISA Kit for detection of MMP2 in the research laboratory</p>Degré de pureté :Min. 95%Rat IgE ELISA Kit
<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Hamster CHO PLBL2 ELISA Kit
<p>Hamster (CHO) Phospholipase B-Like 2 (PLBL2) ELISA Kit</p>Degré de pureté :Min. 95%Recombinant Human VEGF-C
<p>Human sequence expressed in CHO Cells; purity >95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>Chicken Ovotransferrin (Conalbumin) ELISA Kit
<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>Degré de pureté :Min. 95%Mouse IgE ELISA Kit
<p>Please enquire for more information about Mouse IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Coronavirus (SARS-CoV-2) Spike S1 RBD - Purified from HEK 293
<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>CRP ELISA kit
<p>ELISA kit for the detection of CRP in the research laboratory</p>Degré de pureté :Min. 95%2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine
CAS :<p>2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine is a human analog that has been found to have anticancer properties. It acts as an inhibitor of kinases, which are enzymes involved in the regulation of cell growth and division. This compound induces apoptosis in Chinese hamster ovary cells and inhibits tumor growth in mice. 2-[(1S,2S)-1-Ethyl-2-(phenylmethoxy)propyl]hydrazine has medicinal potential as a cancer therapy due to its ability to inhibit protein kinases that are involved in the development of cancer cells. This compound may be used as a therapeutic agent for various types of cancer, especially those that are resistant to conventional chemotherapy. It has also been detected in human urine, indicating its potential for use as a diagnostic tool for cancer.</p>Formule :C12H20N2ODegré de pureté :Min. 95%Masse moléculaire :208.3 g/molTTC27 antibody
<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>Degré de pureté :Min. 95%Cardiolipin screen IgG/IgM/IgA1 ELISA kit
<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>Degré de pureté :Min. 95%Mouse BAFF ELISA Kit
<p>ELISA kit for detection of BAFF in the research laboratory</p>Degré de pureté :Min. 95%...C-peptide antibody
<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>Rat Haptoglobin ELISA Kit
<p>Please enquire for more information about Rat Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Mouse C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Degré de pureté :Min. 95%Rat Ferritin ELISA Kit
<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%IgG1 κ Isotype Control Fc fusion protein (FITC)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>Degré de pureté :Min. 95%Human IgG ELISA kit
<p>ELISA Kit for detection of IgG in the research laboratory</p>Degré de pureté :Min. 95%(R)-DPN
CAS :<p>(R)-DPN is a selective agonist, which is a chemical compound primarily sourced through synthetic organic chemistry techniques. Its mode of action involves specifically binding to and activating the estrogen-related receptor gamma (ERRγ), a member of the nuclear receptor superfamily. By acting as a highly selective ligand, (R)-DPN modulates the transcriptional activity associated with the ERRγ receptor, influencing various biological pathways.</p>Formule :C15H13NO2Degré de pureté :Min. 95%Masse moléculaire :239.27 g/molHuman Cystatin C ELISA kit
<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>Degré de pureté :Min. 95%Rabbit MMP1 ELISA kit
<p>ELISA Kit for detection of MMP1 in the research laboratory</p>Degré de pureté :Min. 95%ANA ELISA kit
<p>ELISA kit for the detection of ANA in the research laboratory</p>Degré de pureté :Min. 95%Cat IgG ELISA Kit
<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>Degré de pureté :Min. 95%Rat IL23 ELISA kit
<p>ELISA Kit for detection of IL23 in the research laboratory</p>Degré de pureté :Min. 95%Human RBP4 ELISA Kit
<p>ELISA kit for detection of RBP4 in the research laboratory</p>Degré de pureté :Min. 95%Grams iodine stain
CAS :<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>Formule :I3K3Degré de pureté :Min. 95%Masse moléculaire :498.01 g/molCat CRP ELISA Kit
<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>Degré de pureté :Min. 95%Dog Thymidine Kinase (TK1) ELISA Kit
<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>Degré de pureté :Min. 95%IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>Degré de pureté :Min. 95%Human Complement C3a des Arg ELISA kit
<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>Degré de pureté :Min. 95%Mouse IGF1 ELISA Kit
<p>ELISA kit for detection of IGF1 in the research laboratory</p>Degré de pureté :Min. 95%Pig IgG ELISA Kit
<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>Degré de pureté :Min. 95%Human GCSF ELISA kit
<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>Degré de pureté :Min. 95%PBB 10
CAS :<p>PBB 10 is a monoclonal antibody that binds to the antigen on the surface of cells. It is used in immunocytochemical staining and immunohistochemical staining techniques, as well as in ELISA assays. PBB 10 can be used for the detection of brominated biphenyls (PBBs) in liquid samples that are either incubated or not incubated with a brominating agent. PBB 10 can be used for the detection of polychlorinated biphenyls (PCBs) in dry samples that are debrominated before analysis. The antibody is also useful for detecting PCBs in tissues from laboratory animals. PBB 10 stains neural tissue and has been shown to be a ligand for certain receptors in the nervous system.</p>Formule :C12H8Br2Degré de pureté :Min. 95%Masse moléculaire :312 g/molMonkey Fibrinogen ELISA Kit
<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>Degré de pureté :Min. 95%GPR37L1 antibody
<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Degré de pureté :Min. 95%Human Ferritin ELISA Kit
<p>Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Triiodothyronine ELISA kit
<p>ELISA kit for the detection of Triiodothyronine Uptake in the research laboratory</p>Degré de pureté :Min. 95%Parvovirus IgG ELISA kit
<p>ELISA kit for the detection of Parvovirus IgG in the research laboratory</p>Degré de pureté :Min. 95%Influenza A Calibration Kit
<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>Degré de pureté :Min. 95%Mouse IL16 ELISA kit
<p>ELISA Kit for detection of IL16 in the research laboratory</p>Degré de pureté :Min. 95%Mouse Vasopressin ELISA kit
<p>ELISA Kit for detection of Vasopressin in the research laboratory</p>Degré de pureté :Min. 95%Human IL8 ELISA Kit
<p>ELISA kit for detection of Human IL8 in the research laboratory</p>Degré de pureté :Min. 95%Dequalinium chloride hydrate
CAS :<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>Formule :C30H40N4•Cl2•(H2O)xDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :545.6 g/molMouse IGFBP1 ELISA Kit
<p>ELISA kit for detection of IGFBP1 in the research laboratory</p>Degré de pureté :Min. 95%EPO ELISA kit
<p>ELISA kit for the detection of EPO in the research laboratory</p>Degré de pureté :Min. 95%PKCβpseudosubstrate
CAS :<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>Formule :C177H294N62O38S3Degré de pureté :Min. 95%Masse moléculaire :3,995 g/molSalivary Sample Collection Kit
<p>Salivary sample collection kit for the detection of free Salivary proteins and enzymes in the research laboratory</p>Degré de pureté :Min. 95%Lactoferrin ELISA kit
<p>ELISA kit for the detection of Lactoferrin in the research laboratory</p>Degré de pureté :Min. 95%Human IL1 α ELISA kit
<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>Degré de pureté :Min. 95%Gliadin screen ELISA kit
<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>Degré de pureté :Min. 95%Human HGF ELISA kit
<p>ELISA kit for the detection of Human HGF in the research laboratory</p>Degré de pureté :Min. 95%SB 202190 hydrochloride
CAS :<p>Inhibitor of p38 MAPK kinase</p>Formule :C20H15ClFN3ODegré de pureté :Min. 95%Masse moléculaire :367.8 g/molMots-C
CAS :<p>Mots-C is a mitochondrial-derived peptide, which is encoded by the small open reading frame found within the mitochondrial 12S rRNA. This peptide functions by interacting with the cellular metabolic pathways to enhance mitochondrial bioenergetics and overall cellular metabolism. Mechanistically, Mots-C modulates the folate–methionine cycle, directly impacting glucose regulation and energy utilization, and consequently facilitating cellular adaptation to metabolic stress.</p>Formule :C101H152N28O22S2Degré de pureté :Min. 95%Masse moléculaire :2,174.6 g/molProthrombin IgG/IgM ELISA kit
<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>Degré de pureté :Min. 95%Human IgA ELISA kit
<p>ELISA Kit for detection of IgA in the research laboratory</p>Degré de pureté :Min. 95%Human Prolactin ELISA kit
<p>ELISA Kit for detection of Prolactin in the research laboratory</p>Degré de pureté :Min. 95%Rat AVP ELISA kit
<p>ELISA Kit for detection of AVP in the research laboratory</p>Degré de pureté :Min. 95%Human Perforin 1 ELISA kit
<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>Degré de pureté :Min. 95%Peptide YY(3-36), PYY, human
<p>Custom research peptide; min purity 95%.</p>Formule :C180H279N53O54Degré de pureté :Min. 95%Masse moléculaire :4,049.55 g/molHorse IgG ELISA Kit
<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>Degré de pureté :Min. 95%Human MMP3 ELISA Kit
<p>ELISA Kit for detection of MMP3 in the research laboratory</p>Degré de pureté :Min. 95%Hamster CHO Matrix metalloproteinase-19 (MMP-19) ELISA Kit
<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>Degré de pureté :Min. 95%Mouse Prealbumin ELISA Kit
<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Degré de pureté :Min. 95%Human CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>Degré de pureté :Min. 95%Head activator
<p>Catalogue peptide; min. 95% purity</p>Formule :C54H84N12O14Masse moléculaire :1,125.36 g/molMesotocin trifluroacetate
CAS :<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Formule :C43H66N12O12S2Degré de pureté :Min. 95%Masse moléculaire :1,007.19 g/molCJC-1295
CAS :<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Degré de pureté :Min. 95%Myelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS :<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Formule :C118H177N35O29S•C2HO2F3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :2,695.98 g/molH-His-Arg-OH
CAS :<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Formule :C12H21N7O3Degré de pureté :Min. 95%Masse moléculaire :311.34 g/molAmyloid beta-Protein (36-38)
CAS :<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Formule :C9H17N3O4Degré de pureté :Min. 95%Masse moléculaire :231.25 g/mol[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Formule :C55H94N20O21Masse moléculaire :1,371.48 g/molProlactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formule :C157H244N54O41SMasse moléculaire :3,576.01 g/mol05:0 PC
CAS :<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Formule :C18H36NO8PDegré de pureté :Min. 95%Masse moléculaire :425.45 g/mol
