Produits biochimiques et réactifs

<p>Cat IgE ELISA Kit</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>Please enquire for more information about CHO NUCB2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hamster (CHO) Nidogen-1 ELISA Kit<br> <br>Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.</p>

<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>

<p>ELISA kit for detection of IGF1 in the research laboratory</p>

<p>Horse Haptoglobin ELISA Kit</p>

<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>

<p>Mouse Plasminogen ELISA Kit</p>

<p>ELISA kit for the detection of dsDNA IgM in the research laboratory</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>

<p>ELISA kit for the detection of ANCA combi in the research laboratory</p>

<p>ELISA kit for detection of Human IL10 in the research laboratory</p>

<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Estradiol in the research laboratory</p>

<p>Pig IgM ELISA Kit</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Rabbit IgM ELISA Kit</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>Cysteine peptide (Ac RFAAKAA COOH) is used in combination with Lysinepeptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.<br>Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.<br>The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.<br>It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.<br>Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).<br>In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.</p>

<p>ELISA kit for detection of Human IL8 in the research laboratory</p>

<p>ELISA kit for detection of IGFBP1 in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgM in the research laboratory</p>

<p>Mouse IgG ELISA Kit - For the quantitative determination of total mouse IgG in biological samples that may contain bovine,horse or human proteins immunoglobulins.</p>

<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>

<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>

<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>

<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>ELISA kit for the detection of ENA in the research laboratory</p>

<p>Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Azido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of ssDNA in the research laboratory</p>

<p>ELISA Kit for detection of NGFb in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>ELISA kit for detection of PSA in the research laboratory</p>

<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>

<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>

<p>Cat IgM ELISA Kit</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Horse IgA ELISA Kit</p>

<p>ELISA kit for the detection of Histamine in foodstuffs in the research laboratory</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA kit for the detection of LH in the research laboratory</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>This Human Transferrin ELISA Kit reacts similarly with apo-transferrin and holo-transferrin.</p>

<p>Rat NGAL ELISA Kit</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>ELISA kit for the detection of OPG in the research laboratory</p>

<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>

<p>Hamster (CHO) Annexin A5 ELISA Kit<br> <br>Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>ELISA kit for the detection of Jo1 in the research laboratory</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>ELISA Kit for detection of IL25 in the research laboratory</p>

<p>ELISA kit for the detection of PGE2 in the research laboratory</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>ELISA kit for the detection of Dengue Virus IgM in the research laboratory</p>

<p>ELISA Kit for detection of MIP3 alpha in the research laboratory</p>

<p>ELISA kit for detection of Neurotrophin3 in the research laboratory</p>

<p>ELISA kit for detection of IGF1 in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin IgG in the research laboratory</p>

<p>ELISA Kit for detection of IgM in the research laboratory</p>

<p>Dog Red Blood Cells (DRBC) are biospecimens that can be used in various research applications in the life sciences and veterinary fields. These cells have been extensively studied and characterized for their molecular properties. DRBC have been used in molecular docking studies to investigate interactions with specific targets, such as 3T3-L1 preadipocytes or activated nuclear extracts. DRBC can also be used in assays to measure specific molecules or enzymes. For example, they have been used to study the effects of thiocyanate on human enzymes or to develop monoclonal antibodies against certain targets. Additionally, DRBC can be utilized in polymerase chain reaction (PCR) experiments for genetic analysis. In veterinary applications, DRBC have been employed to study the cation transport mechanisms or growth hormone receptor activation in dogs. They have also been used to measure creatine kinase levels, which can indicate muscle damage. Overall, Dog Red Blood Cells are valuable resources for researchers and veterinarians seeking to understand various biological</p>

<p>ELISA kit for the detection of SSB in the research laboratory</p>

<p>ELISA kit for the detection of Human Complement C3a des Arg in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>Human IgG &amp; IgM Primer Set</p>

<p>ELISA kit for the detection of Cystatin C in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA kit for the detection of Sperm Antibodies in the research laboratory</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>

<p>Tosedostat-d5 is an analog of Tosedostat, an anticancer drug that inhibits the activity of a variety of kinases involved in cancer cell growth and survival. This compound has been shown to induce apoptosis in human cancer cells and has demonstrated promising results in preclinical studies. Tosedostat-d5 is labeled with five deuterium atoms, which makes it useful as a tracer for pharmacokinetic and metabolic studies. It is also used as a tool for investigating the metabolism of other drugs, such as rifampicin and astaxanthin, in Chinese hamster ovary cells. Inhibitors of tosedostat-d5 have been developed for use in cancer therapy, making this compound an important tool for research into new anticancer treatments.</p>

<p>Please enquire for more information about 1,9-Dichloro-3,7-diazanonane dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>ELISA kit for detection of CXCL10 in the research laboratory</p>

<p>ELISA kit for detection of Lipocalin 2 in the research laboratory</p>

<p>ELISA kit for detection of Growth Hormone in the research laboratory</p>

<p>ELISA kit for detection of Triiodothyronine in the research laboratory</p>

<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory</p>

<p>ELISA kit for the detection of SSA  in the research laboratory</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>PBB 10 is a monoclonal antibody that binds to the antigen on the surface of cells. It is used in immunocytochemical staining and immunohistochemical staining techniques, as well as in ELISA assays. PBB 10 can be used for the detection of brominated biphenyls (PBBs) in liquid samples that are either incubated or not incubated with a brominating agent. PBB 10 can be used for the detection of polychlorinated biphenyls (PCBs) in dry samples that are debrominated before analysis. The antibody is also useful for detecting PCBs in tissues from laboratory animals. PBB 10 stains neural tissue and has been shown to be a ligand for certain receptors in the nervous system.</p>

<p>Mouse TNF-alpha ELISA Kit</p>

<p>The Goat IgG ELISA kit is intended for the quantitative determination of total goat IgG in biological samples. This product will not react with sheep IgG or Bovine IgG.</p>

<p>Cat Haptoglobin ELISA Kit</p>

<p>Human Myoglobin ELISA Kit</p>

<p>This Porcine epidemic diarrhea virus nucleocapsid protein is expressed in E.coli and contains a 6xHIS tag.</p>

<p>Please enquire for more information about Human Retinol Binding Protein ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Please enquire for more information about Mouse KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human sequence expressed in sf Insect Cells; purity &gt;97% by SDS-PAGE and analyzed by silver stain.</p>

<p>Human IgD ELISA Kit</p>

<p>Mouse Cystatin C ELISA Kit</p>

<p>Quantify total bovine IgA in your samples.</p>

<p>Rat KIM-1 ELISA Kit</p>

<p>Rat Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>

<p>Rat Osteopontin ELISA Kit</p>

<p>Human KIM-1 ELISA Kit</p>

<p>Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>Please enquire for more information about Human Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Antithrombin III ELISA Kit</p>

<p>Hamster (CHO) Phospholipase B-Like 2 (PLBL2) ELISA Kit</p>

<p>Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse Transferrin ELISA Kit</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Hemoglobin is a protein found in red blood cells that is responsible for carrying oxygen from the lungs to the rest of the body and transporting carbon dioxide from the body back to the lungs. It is a crucial component of the blood, contributing to its red color. Hemoglobin contains iron, which binds to oxygen and gives blood its ability to transport oxygen throughout the body. This process is essential for cellular respiration and energy production in the body.</p>

<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>

<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Thiostatin ELISA Kit</p>

<p>Rat GST alpha ELISA Kit</p>

<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Please enquire for more information about CHO CTSA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>Rat Hemopexin ELISA Kit</p>

<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>

<p>Please enquire for more information about Mouse Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Alpha 1-Microglobulin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Thymus factor X is a protein that has been shown to inhibit proliferation of cancer cells in animal models. It has also been shown to have an inhibitory effect on the growth of mesenteric cancer cells and on human hepatitis B virus. Thymus factor X is a basic protein that stimulates apoptosis, or programmed cell death, by binding to monoclonal antibodies and triggering cellular events that lead to the breakdown of DNA. It also inhibits production of inflammatory cytokines in response to skin tests. Thymus factor X is active against infectious diseases such as tuberculosis, bacterial pneumonia, and chickenpox. The drug is currently being studied for use in treating primary sclerosing cholangitis, which is a chronic inflammatory disease of the bile ducts.<br>Thymus Factor X may be used therapeutically for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, but further research needs to be done before it can be approved for any therapeutic purposes.</p>

<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>

<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>

<p>ELISA kit for the detection of PR3  in the research laboratory</p>

<p>p-Perfluoroterphenyl is a potent inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. This compound has been extensively studied in Chinese medicinal research for its anticancer properties. It has been shown to inhibit the growth of tumor cells and induce apoptosis, or programmed cell death, in cancer cells. Additionally, p-Perfluoroterphenyl has been found to be an effective inhibitor of protein kinases, which regulate many important cellular processes. This analog has also been detected in human urine samples, indicating its potential as a diagnostic tool for cancer detection and treatment. Overall, p-Perfluoroterphenyl is a promising new compound with potential applications in cancer therapy and diagnosis.</p>

<p>Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione is a potent chemokine molecule that is an agonist of the CXCR2 receptor. It has been shown to inhibit cancer stem cells and chemoattractant production in colon carcinoma cells. This compound selectively targets the translation of lamiaceae mRNA and induces apoptosis in colon carcinoma cells.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Horse IgM ELISA Kit</p>

<p>Please enquire for more information about Fumaric acid-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Human HGF in the research laboratory</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Influenza A Antigen Capture ELISA for use in the research laboratory</p>

<p>Histamine ELISA Kit for the quantitative determination of Histamine in plasma and urine</p>

<p>ELISA kit for detection of Thyroxine in the research laboratory</p>

<p>ELISA Kit for detection of Leukotriene B4 in the research laboratory</p>

<p>ELISA Kit for detection of NGFb in the research laboratory</p>

<p>FSH ELISA kit for the quantitative measurement of FSH in human serum</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>ELISA kit for the detection of TRAIL in the research laboratory</p>

<p>Human Novel Coronavirus Nucleoprotein (SARS-CoV-2 N) IgG Ab ELISA Kit</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>ELISA kit for the detection of Prothrombin screen in the research laboratory</p>

<p>ELISA Kit for detection of TARC in the research laboratory</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>