Produits biochimiques et réactifs

<p>A reliable ELISA Kit for quantifying soluble interleukin-2 receptor (sIL-2R, sIL2R, sTAC, sCD25) in dog serum/plasma samples.</p>

<p>For the quantitative determination of chicken immunoglobulin M (IgM) in biological samples.;</p>

<p>Quantify total bovine IgA in your samples.</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>

<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>

<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>

<p>Rat KIM-1 ELISA Kit</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Cat IgM ELISA Kit</p>

<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Monkey IgA ELISA kit is intended for the quantitative determination of total monkey IgA (new and old world) in biological samples.</p>

<p>Human sequence expressed in CHO Cells; purity &gt;95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>

<p>Mouse Transferrin ELISA Kit</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Hemoglobin is a protein found in red blood cells that is responsible for carrying oxygen from the lungs to the rest of the body and transporting carbon dioxide from the body back to the lungs. It is a crucial component of the blood, contributing to its red color. Hemoglobin contains iron, which binds to oxygen and gives blood its ability to transport oxygen throughout the body. This process is essential for cellular respiration and energy production in the body.</p>

<p>Horse Haptoglobin ELISA Kit</p>

<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>

<p>Mouse Plasminogen ELISA Kit</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hamster (CHO) Legumain ELISA Kit<br> <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>

<p>ELISA kit for the detection of dsDNA IgA in the research laboratory</p>

<p>ELISA kit for the detection of cAMP in the research laboratory</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>ELISA kit for the detection of ENA in the research laboratory</p>

<p>Ready to use Dog/Canine Cystatin C ELISA Kit</p>

<p>ELISA kit for the detection of PGE2 in the research laboratory</p>

<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of PTH intact in the research laboratory</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Goat IgG ELISA kit is intended for the quantitative determination of total goat IgG in biological samples. This product will not react with sheep IgG or Bovine IgG.</p>

<p>Recombinant Human POLR2K protein</p>

<p>ELISA Kit for detection of Estradiol in the research laboratory</p>

<p>ELISA Kit for detection of PPARa in the research laboratory</p>

<p>Biotin labeling kit for IgG</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>ELISA kit for the detection of LH in the research laboratory</p>

<p>Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>EVX1 antibody was raised in rabbit using the middle region of EVX1 as the immunogen</p>

<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>

<p>Dog Alpha 1-Acid Glycoprotein ELISA Kit</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>

<p>ELISA kit for the detection of Fibronectin in the research laboratory</p>

<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>

<p>Hamster (CHO) Nidogen-1 ELISA Kit<br> <br>Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>ELISA kit for the detection of Human Leptin in the research laboratory</p>

<p>ELISA kit for detection of Neurotrophin3 in the research laboratory</p>

<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cat IgE ELISA Kit</p>

<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>Monkey Red Blood Cells are a valuable resource in the field of Life Sciences. These cells can be used for various applications such as studying the angiotensin-converting enzyme, neutralizing antibodies, and electrode development. Monkey Red Blood Cells are often used in research to develop monoclonal antibodies and pegylated products. They can also be used as biospecimens for the analysis of serum, plasma, and other fluids. Additionally, Monkey Red Blood Cells have been utilized in studies involving collagen, human serum, peptide agents, influenza hemagglutinin, brucella abortus, carbon quantum dots, chemokines, and growth factors. These cells offer researchers a reliable and versatile tool for their scientific investigations.</p>

<p>Please enquire for more information about Human Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dog IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>

<p>Bovine Transferrin ELISA Kit</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>

<p>ELISA kit for the detection of dsDNA IgM in the research laboratory</p>

<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>

<p>ELISA Kit for detection of leukotriene E4 in the research laboratory</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>ELISA kit for detection of CD40 in the research laboratory</p>

<p>ELISA kit for the detection of ASCA IgA/IgG in the research laboratory</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>

<p>Portion of Influenza M</p>

<p>D-Threonic acid lithium salt is a cell signaling molecule that belongs to the class of ligands. It has been used as a research tool in pharmacology and protein interaction studies. D-Threonic acid lithium salt can activate ion channels, which are cellular membrane proteins that allow ions to flow in or out of cells. D-Threonic acid lithium salt also interacts with receptors, which are proteins on the surface of cells that receive chemical signals from outside the cells. Receptors can be either agonists or antagonists. D-Threonic acid lithium salt is a ligand for receptor tyrosine kinase, which is involved in cell growth and differentiation.</p>

<p>ELISA kit for detection of Human IL6 in the research laboratory</p>

<p>ELISA Kit for detection of SCF in the research laboratory</p>

<p>ELISA kit for detection of IGFBP1 in the research laboratory</p>

<p>ELISA kit for the detection of ANCA combi in the research laboratory</p>

<p>Human Kappa ELISA Kit</p>

<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>

<p>ELISA kit for detection of Human IL10 in the research laboratory</p>

<p>Mouse IgG ELISA Kit - For the quantitative determination of total mouse IgG in biological samples that may contain bovine,horse or human proteins immunoglobulins.</p>

<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for detection of Human IL8 in the research laboratory</p>

<p>Please enquire for more information about Human Alpha 1-Antichymotrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Quantify dog hemoglobin in your samples.</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Please enquire for more information about Rat C3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Guinea Pig IgM ELISA Kit</p>

<p>Please enquire for more information about Mouse CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human NGAL ELISA Kit</p>

<p>Please enquire for more information about Dog KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Prealbumin (TTR) ELISA Kit</p>

<p>FSH ELISA kit for the quantitative measurement of FSH in human serum</p>

<p>Guinea Pig IgA ELISA Kit</p>

<p>Cat IgA ELISA Kit</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>

<p>ELISA Kit for detection of Leukotriene B4 in the research laboratory</p>

<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>ELISA kit for the detection of Dopamine in the research laboratory</p>

<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>

<p>ELISA Kit for detection of PGD2 in the research laboratory</p>

<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>

<p>The CYP2A6 antibody is a monoclonal antibody that targets the protein kinase CYP2A6. This antibody can be used for various applications, including immunohistochemical detection and clinical use as a medicament. CYP2A6 is an enzyme that plays a crucial role in the metabolism of several compounds, including cotinine. It is also involved in the activation of procarcinogens and the detoxification of xenobiotics. The CYP2A6 antibody can be used to study the expression and localization of CYP2A6 in different tissues and cell types, making it a valuable tool in life sciences research. Additionally, this antibody may have potential applications in the development of novel antibacterial agents.</p>

<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>

<p>Rat Osteopontin ELISA Kit</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>ELISA kit for detection of Thyroxine in the research laboratory</p>

<p>Rat Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>

<p>Bovine IL-6 ELISA Kit</p>

<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG in biological samples.</p>

<p>Mouse Cystatin C ELISA Kit</p>

<p>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>ELISA kit for the detection of Parvovirus IgG in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>Please enquire for more information about Human Retinol Binding Protein ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified recombinant Human DECR1 protein</p>

<p>ELISA Kit for detection of HCG in the research laboratory</p>

<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA kit for the detection of Rat CRP in the research laboratory</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial. Big Endothelin-1 (Human, 1-38) is part of the full lengthed 29 amino acid peptide Big Endothlin-1 which is a precursor peptide of the vasoconstrictorEndothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.<br>Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>ELISA Kit for detection of Triiodothyronine in the research laboratory</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>ELISA kit for detection of RBP4 in the research laboratory</p>

<p>Enzyme Immunoassay for the Quantitative Determination of purified M13 Bacteriophage Particles</p>

<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA kit for detection of CXCL10 in the research laboratory</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been extensively studied using advanced techniques such as the patch-clamp technique on human erythrocytes. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal GDI2 antibody (biotin)</p>

<p>ELISA kit for detection of TIMP2 in the research laboratory</p>

<p>ELISA kit for the detection of Human HGF in the research laboratory</p>

<p>ELISA kit for detection of Histamine in the research laboratory</p>

<p>Human Apolipoprotein H ELISA Kit</p>

<p>Recombinant Human ARFIP1 protein</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>

<p>ELISA kit for the detection of AFP in the research laboratory</p>

<p>Arabidopsis Thaliana Plant Lysate</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgM in the research laboratory</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>Mouse monoclonal anti human CREG1 antibody</p>

<p>ELISA kit for detection of Mouse RANKL in the research laboratory</p>

<p>ELISA kit for detection of Rat PAI1 in the research laboratory</p>

<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>Please enquire for more information about Human Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dog Osteopontin ELISA Kit - OPN is confined to the distal parts of a subset of nephrons. In the kidney the expression of OPN is severely upregulated during renal injury.Â</p>

<p>Troponin1 is a protein that is found in the muscle cells of humans. Troponin1 binds to actin, tropomyosin, and troponin C, which are proteins that make up the thin filament of the sarcomere. Tropomyosin blocks actin binding sites on the thin filament and prevents cross-bridge formation. When tropomyosin is displaced by troponins, it exposes these sites for interaction with myosin heads, which form cross-bridges with actin. Troponins also regulate calcium release from the sarcoplasmic reticulum during excitation-contraction coupling. The human troponins are encoded by different genes and are identified as TNN1 (Troponin 1), TNN2 (Troponin 2), TNN3 (Troponin 3), or TNN4 (Troponin 4). This antibody reacts with human cardiac and skeletal muscle tropomyosins and not</p>

<p>ELISA kit for detection of IL18 in the research laboratory</p>

<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>

<p>Affinity purified Rabbit polyclonal XPR1 antibody</p>

<p>Rat Myoglobin ELISA Kit</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>