Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.563 produits)
- Par Biological Target(101.038 produits)
- Par usage/effets pharmacologiques(6.954 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.368 produits)
130636 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
HMGB1 protein
1-215 amino acids: MGKGDPKKPR GKMSSYAFFV QTCREEHKKK HPDASVNFSE FSKKCSERWK TMSAKEKGKF EDMAKADKAR YEREMKTYIP PKGETKKKFK DPNAPKRPPS AFFLFCSEYR PKIKGEHPGL SIGDVAKKLG EMWNNTAADD KQPYEKKAAK LKEKYEKDIA AYRAKGKPDA AKKGVVKAEK SKKKKEEEED EEDEEDEEEE EDEEDEDEEE DDDDELEHHH HHHDegré de pureté :Min. 95%UTY antibody
UTY antibody was raised using the middle region of UTY corresponding to a region with amino acids ESNRSHTTIAKYAQYQASSFQESLREENEKRTQHKDHSDNESTSSENSGRDegré de pureté :Min. 95%SAMHD1 antibody
SAMHD1 antibody was raised using the middle region of SAMHD1 corresponding to a region with amino acids KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFDegré de pureté :Min. 95%C6ORF140 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf140 antibody, catalog no. 70R-2829
Degré de pureté :Min. 95%OLFML1 antibody
OLFML1 antibody was raised using the middle region of OLFML1 corresponding to a region with amino acids LCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLFFPKRPRSHSMIHDegré de pureté :Min. 95%SF3B1 antibody
SF3B1 antibody was raised using the N terminal of SF3B1 corresponding to a region with amino acids SARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSABCF2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ABCF2 antibody, catalog no. 70R-5704Degré de pureté :Min. 95%CFLAR antibody
CFLAR antibody was raised in rabbit using the N terminal of CFLAR as the immunogenDegré de pureté :Min. 95%PFKP antibody
The PFKP antibody is a monoclonal antibody that targets the PFKP protein. It is commonly used in life sciences research to study various aspects of cell growth and metabolism. The PFKP protein plays a crucial role in glycolysis, the process by which cells convert glucose into energy. This antibody specifically binds to the PFKP protein, inhibiting its catalase activity and preventing the production of ATP.GRO beta protein
Region of GRO beta protein corresponding to amino acids VVVASELRCQ CLTTLPRVDF KNIQSLTVTP PGPHCAQTEV IATLKDGHEV CLNPEAPLVQ RIVQKILNKG KAN.Degré de pureté :Min. 95%KIAA0494 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0494 antibody, catalog no. 70R-1815
Degré de pureté :Min. 95%GAPDH antibody
GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCSNRPN antibody
SNRPN antibody was raised in rabbit using the N terminal of SNRPN as the immunogenDegré de pureté :Min. 95%QRSL1 antibody
QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTD-dimer antibody
The D-dimer antibody is a highly specialized product used in the field of Life Sciences. It is an electrode-activated monoclonal antibody that exhibits cytotoxic properties. This antibody specifically targets transthyretin and acts as an anti-connexin agent. It is commonly used in various assays and tests to detect the presence of D-dimer in human serum, which is an important marker for blood clotting disorders. Additionally, this antibody has shown promising results in interfering with interferon signaling pathways. With its unique immobilization capabilities, the D-dimer antibody offers researchers a powerful tool for studying various biological processes and developing diagnostic tools for related conditions.Phencyclidine antibody
Phencyclidine antibody is a highly specialized inhibitor that targets the growth factor and acts as an anti-connexin agent. It is commonly used in Life Sciences, specifically in research related to helicobacter and chemokine. This antibody is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments. The colloidal microsphere formulation ensures efficient binding to the target molecules, enhancing the accuracy of experimental results. Additionally, this antibody has demonstrated efficacy in inhibiting telomerase activity and phosphorylcholine signaling pathways. Researchers can also utilize this antibody as a substrate for siRNA delivery or as an endothelial growth factor in cell culture studies. With its wide range of applications, the Phencyclidine antibody is a valuable tool for researchers in various fields of study.Degré de pureté :Min. 95%SHH antibody
The SHH antibody is a monoclonal antibody that specifically targets the Sonic Hedgehog (SHH) protein isoforms. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. The SHH antibody can be used in research studies to investigate the role of SHH in development, cell signaling, and disease processes.Calcyclin antibody
Calcyclin antibody was raised in Mouse using a purified recombinant fragment of calcyclin expressed in E. coli as the immunogen.C2ORF47 antibody
C2ORF47 antibody was raised using the middle region of C2Orf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLEABCE1 antibody
ABCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
Degré de pureté :Min. 95%PARP6 antibody
PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENWTXNDC15 antibody
TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV
Degré de pureté :Min. 95%Cacng1 antibody
Cacng1 antibody was raised in rabbit using the N terminal of Cacng1 as the immunogenDegré de pureté :Min. 95%HERC6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HERC6 antibody, catalog no. 70R-2770
Degré de pureté :Min. 95%
