Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.560 produits)
- Par Biological Target(101.036 produits)
- Par usage/effets pharmacologiques(6.953 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130609 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Antithrombin III antibody (HRP)
Antithrombin III antibody (HRP) was raised in sheep using human antithrombin purified from plasma as the immunogen.SOS1 antibody
The SOS1 antibody is a highly specialized antibody that targets the SOS1 protein, an oncogene homolog involved in cell signaling pathways. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.SLC19A1 antibody
SLC19A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPGLRX3 antibody
GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRGoat anti Human IgG (H + L) (Fab'2)
Goat anti-human IgG (H+L) (Fab'2) was raised in goat using human IgG whole molecule as the immunogen.Degré de pureté :Min. 95%COPG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of COPG antibody, catalog no. 70R-3810Degré de pureté :Min. 95%Glycogen Synthase antibody
The Glycogen Synthase antibody is a powerful tool in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets glycogen synthase, an enzyme involved in glycogen synthesis. This antibody has been extensively studied and validated for its high specificity and sensitivity.
Rad21 antibody
Rad21 antibody was raised in rabbit using the C terminal of Rad21 as the immunogenDegré de pureté :Min. 95%USP8 antibody
USP8 antibody was raised in rabbit using the C terminal of USP8 as the immunogen
Degré de pureté :Min. 95%ELMOD1 antibody
ELMOD1 antibody was raised in rabbit using the middle region of ELMOD1 as the immunogen
Degré de pureté :Min. 95%Pigw antibody
Pigw antibody was raised in rabbit using the middle region of Pigw as the immunogenDegré de pureté :Min. 95%VPS4A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VPS4A antibody, catalog no. 70R-2376Degré de pureté :Min. 95%1,2-Distearoyl-sn-glycero-3-phosphocholine-N,N,N-trimethyl-d9
CAS :Produit contrôlé1,2-Distearoyl-sn-glycero-3-phosphocholine (DSC) is a lipid molecule that is used as a research tool. It is an inhibitor of the protein kinase C (PKC) and also has been shown to have other effects on proteins involved in cell signaling. DSC binds to receptors and ion channels and inhibits their function. This inhibitory effect may be due to the ability of DSC to bind to PKC, thereby preventing PKC from phosphorylating its target proteins. DSC has been shown to be a ligand for the peroxisome proliferator activated receptor alpha (PPARα), which regulates fat metabolism.
Formule :C44H79NO8PD9Degré de pureté :Min. 95%Masse moléculaire :799.2 g/molALDH4A1 antibody
ALDH4A1 antibody was raised using the C terminal of ALDH4A1 corresponding to a region with amino acids RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIClavulanate Lithium
Clavulanate Lithium (USP grade powder) chemical reference substanceDegré de pureté :Min. 95%FIBCD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FIBCD1 antibody, catalog no. 70R-6987Degré de pureté :Min. 95%2-Amino-6-fluoro-N-[5-fluoro-4-(1-methyl-1H-imidazol-5-yl)-3-pyridinyl]pyrazolo[1,5-a]pyrimidine-3-carboxamide
CAS :2-Amino-6-fluoro-N-[5-fluoro-4-(1-methyl-1H-imidazol-5-yl)-3-pyridinyl]pyrazolo[1,5-a]pyrimidine-3-carboxamide is an inhibitor of viral RNA synthesis. It is a potent inhibitor of the human immunodeficiency virus type 1 (HIV) reverse transcriptase and has been shown to reduce the production of HIV in vitro. 2AFNPYPC is also active against hepatitis B virus (HBV). This drug binds to the active site of HIV reverse transcriptase and HBV polymerase, respectively. The binding affinity for these two enzymes is similar, suggesting that this drug may be effective against other viruses with a similar enzyme target.Formule :C16H12F2N8ODegré de pureté :Min. 95%Masse moléculaire :370.32 g/molPDGFRB antibody
PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%IFI35 antibody
IFI35 antibody was raised in mouse using recombinant Human Interferon-Induced Protein 35 (Ifi35)PER2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PER2 antibody, catalog no. 70R-8370
Degré de pureté :Min. 95%NCAPH2 antibody
NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEXAB2 antibody
XAB2 antibody was raised in rabbit using the N terminal of XAB2 as the immunogenDegré de pureté :Min. 95%p53 antibody
The p53 antibody is a neutralizing monoclonal antibody that targets the influenza hemagglutinin protein. It is commonly used in Life Sciences research to study the effects of various growth factors and drugs, such as pioglitazone, on cellular processes. The p53 antibody is produced by hybridoma cells and has been shown to specifically bind to p53 protein expressed in human hepatocytes and other cell types. This antibody can be used for applications such as immunofluorescence, immunohistochemistry, and Western blotting to detect and quantify the levels of p53 protein in various samples. Its high specificity and affinity make it a valuable tool for researchers studying cell signaling pathways, cancer biology, and other related fields.VASP antibody
The VASP antibody is a highly specific monoclonal antibody that can be used in various applications in the field of life sciences. This antibody specifically targets VASP (Vasodilator-Stimulated Phosphoprotein), a protein involved in cell signaling and cytoskeletal dynamics. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs.ZFP28 antibody
ZFP28 antibody was raised in rabbit using the middle region of ZFP28 as the immunogenDegré de pureté :Min. 95%Goat anti Human IgG (rhodamine)
This antibody reacts with heavy chains on human IgG (gamma chain).Degré de pureté :Min. 95%THAP1 antibody
The THAP1 antibody is a polypeptide that exhibits strong antibody activity. It is a protein that specifically targets and binds to THAP1, a transcription factor associated with various biological processes in the cell. This antibody can be used in research, diagnostics, and therapeutics in the field of life sciences. Its high specificity and affinity make it a valuable tool for studying the function and regulation of THAP1, as well as its potential role in disease development. With its ability to recognize and bind to THAP1, this antibody enables researchers to investigate the impact of THAP1 on cellular processes and explore its therapeutic potential in various diseases.BMP10 antibody
The BMP10 antibody is a highly specialized product used in Life Sciences research. It is designed to target and bind to the BMP10 protein, which plays a crucial role in the development and function of neonatal cardiac myocytes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
RPL6 antibody
RPL6 antibody was raised using the N terminal of RPL6 corresponding to a region with amino acids AGEKVEKPDTKEKKPEAKKVDAGGKVKKGNLKAKKPKKGKPHCSRNPVLV
![2-Amino-6-fluoro-N-[5-fluoro-4-(1-methyl-1H-imidazol-5-yl)-3-pyridinyl]pyrazolo[1,5-a]pyrimidine-3…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FNPC20051.webp&w=3840&q=75)
