Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.563 produits)
- Par Biological Target(101.024 produits)
- Par usage/effets pharmacologiques(6.952 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130609 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
S100 antibody
The S100 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to specific antigens, particularly histidine phosphatase. This antibody is widely used in research and diagnostic applications to detect the presence of autoantibodies or other specific proteins of interest.Synuclein antibody
The Synuclein antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that targets specific molecules involved in lipid peroxidation. This antibody has been extensively studied and proven to have antioxidant activity, making it an essential tool for researchers studying oxidative stress and related diseases.Drebrin antibody
Drebrin antibody was raised in mouse using synthetic c-terminal peptide (aa 632-649) coupled to KLH as the immunogen.Goat anti Rat IgG (Fab'2) (HRP)
Goat anti-rat IgG (Fab'2) (HRP) was raised in goat using Rat IgG F(c) whole molecule as the immunogen.Degré de pureté :Min. 95%CDS1 antibody
CDS1 antibody was raised in rabbit using the N terminal of CDS1 as the immunogen
Degré de pureté :Min. 95%EFEMP2 antibody
EFEMP2 antibody was raised using the middle region of EFEMP2 corresponding to a region with amino acids VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTFDegré de pureté :Min. 95%SERPINB5 antibody
SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNMHuman IgM protein
Human IgM protein is a lipoprotein lipase that plays a crucial role in various biological processes. It acts as a growth factor and interferon, regulating the metabolism of fatty acids and promoting immune responses. This protein can be used in various applications, including the production of monoclonal antibodies for diagnostic purposes, immobilization on colloidal particles for antiviral assays, and electrode coatings for biosensors. Human IgM protein is purified from human serum and contains highly specific monoclonal antibodies that target specific antigens. Its neuroprotective properties make it an essential component in Life Sciences research. With its wide range of applications and high purity, Human IgM protein is an invaluable tool for researchers in the field of immunology and beyond.Degré de pureté :>95% Pure By Sds-PageTBCCD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TBCCD1 antibody, catalog no. 70R-3697Degré de pureté :Min. 95%CHRM2 antibody
The CHRM2 antibody is a highly specialized polyclonal antibody that is designed to target the CHRM2 receptor. This receptor plays a crucial role in various biological processes, including cell signaling and neurotransmission. The CHRM2 antibody is available in both monoclonal and polyclonal forms, allowing for flexibility in experimental design.
CDC45L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CDC45L antibody, catalog no. 70R-5557Degré de pureté :Min. 95%Goat anti Human Lambda Chain (HRP)
Goat anti-human lambda chain (HRP) was raised in goat using human l lambda light chain as the immunogen.Degré de pureté :Min. 95%TGF α antibody
The TGF alpha antibody is a monoclonal antibody that specifically targets and binds to transforming growth factor alpha (TGF-alpha). It is commonly used in various research applications, including studies on breast cancer cells (such as MCF-7), intraocular diseases, and TGF-beta signaling pathways. This antibody can be used for immunohistochemistry, immunofluorescence, western blotting, and other techniques to detect and quantify the presence of TGF-alpha in biological samples.ADD3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADD3 antibody, catalog no. 70R-9941
Degré de pureté :Min. 95%GJC2 antibody
GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVWDegré de pureté :Min. 95%NEK6 antibody
The NEK6 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets NEK6, a protein kinase involved in cell cycle regulation and cellular processes. This antibody has been widely used in studies related to collagen synthesis, electrode development, and the identification of inhibitory factors. It has also shown cytotoxic effects on certain cancer cells and has been used as a growth factor in cell culture experiments. Additionally, the NEK6 antibody can be used for the detection and quantification of NEK6 in various biological samples such as pleural fluid, human serum, and other body fluids. Its high specificity and affinity make it a valuable tool for researchers studying biomolecules, binding proteins, glutamate signaling pathways, chemokine receptors, and other related areas of research.HDAC10 antibody
The HDAC10 antibody is a highly specific polyclonal antibody that targets the protein HDAC10. It can be used in various life science applications, including research and diagnostics. This antibody is produced using human monoclonal antibodies, ensuring high specificity and sensitivity.BNIP3 antibody
The BNIP3 antibody is a highly effective inhibitor used in the industrial sector. It belongs to the class of polyclonal antibodies and works by targeting specific antigens. This antibody has been shown to inhibit protein kinase activity, making it an essential tool in various research applications. Additionally, it has been found to have a significant impact on interferon and collagen production, making it a valuable asset in the field of life sciences. The BNIP3 antibody is also used for polypeptide expression and has been found to be effective in detecting autoantibodies. With its recombinant antigen properties, this antibody is widely used in microvessel endothelial cell studies.NOX2 Antibody
The NOX2 Antibody is a highly specialized monoclonal antibody that targets thrombocytopenia, a condition characterized by low platelet count. This antibody specifically binds to the insulin-like growth factor receptor (IGF-1R) on platelets, leading to their activation and increased production of dopamine and tyrosine hydroxylase. As a result, the NOX2 Antibody promotes platelet survival and proliferation, thereby improving overall blood clotting function. In addition to its therapeutic applications in treating thrombocytopenia, this antibody has also shown cytotoxic effects against certain cancer cells by targeting specific antigens such as alpha-synuclein. Its potential use in oncology research makes it a valuable tool for scientists in the field of Life Sciences. With its unique mechanism of action and proven efficacy, the NOX2 Antibody represents a promising advancement in the development of targeted therapies for various disorders and diseases.alpha 6 Integrin antibody
alpha 6 Integrin antibody was raised in rat using Mouse mammary tumor cells as the immunogen.DNAJC7 antibody
The DNAJC7 antibody is a powerful tool in the field of Life Sciences. It is an isothiocyanate-conjugated polyclonal antibody that targets DNAJC7, a protein involved in various cellular processes. This antibody has been extensively used in research to study the role of DNAJC7 in insulin signaling, lipoprotein lipase activity, and heparin-induced thrombocytopenia. Additionally, it has been employed in studies investigating the effects of DNAJC7 on growth factors such as trastuzumab and epidermal growth factor. The DNAJC7 antibody offers researchers a valuable tool for understanding the function and regulation of this important glycoprotein. Whether you are studying inhibitors or monoclonal antibodies, this highly specific antibody will provide reliable results for your experiments.STMN1 antibody
The STMN1 antibody is a cyclase-activating and neutralizing monoclonal antibody. It is a biomolecule that specifically targets STMN1, a protein involved in cell cycle regulation and microtubule dynamics. This monoclonal antibody is produced using advanced techniques in the field of Life Sciences and is formulated with high-quality excipients to ensure stability and efficacy.
KCTD9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD9 antibody, catalog no. 70R-3909Degré de pureté :Min. 95%Goat anti Human IgE (epsilon chain)
This antibody reacts with heavy chains on human IgE (epsilon chain).Degré de pureté :Min. 95%ANKRD42 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD42 antibody, catalog no. 70R-4932Degré de pureté :Min. 95%
