Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.563 produits)
- Par Biological Target(101.024 produits)
- Par usage/effets pharmacologiques(6.952 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130609 produits trouvés pour "Produits biochimiques et réactifs"
CARD9 antibody
CARD9 antibody was raised in rabbit using the middle region of CARD9 as the immunogen
Degré de pureté :Min. 95%FAM129A antibody
FAM129A antibody was raised using the N terminal of FAM129A corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKERabbit anti Bovine IgG (HRP)
Rabbit anti-bovine IgG (HRP) was raised in rabbit using bovine IgG F(ab')2 fragment as the immunogen.
Degré de pureté :Min. 95%PROX1 antibody
The PROX1 antibody is a powerful tool for researchers studying growth factors and inhibitors. Antibodies are essential binding proteins that recognize specific biomolecules, allowing researchers to study their functions and interactions. This particular antibody specifically targets PROX1, a transcription factor involved in various cellular processes.Degré de pureté :Min. 95%PKR antibody
The PKR antibody is a highly potent growth factor that targets fibrinogen and other proteins in the body. This antibody, available in both polyclonal and monoclonal forms, is a glycoprotein that specifically binds to PKR (protein kinase R), inhibiting its cytotoxic effects. The PKR antibody has been shown to neutralize the activity of PKR, preventing it from phosphorylating its downstream targets, such as actin filaments and β-catenin. Additionally, this antibody has been found to have a neutralizing effect on interleukin-6, a pro-inflammatory cytokine. The PKR antibody is commonly used in research and diagnostic applications to study the role of PKR in various cellular processes and diseases, including cancer and collagen-related disorders.Degré de pureté :Min. 95%ECHS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ECHS1 antibody, catalog no. 70R-1098
Degré de pureté :Min. 95%BBC3 antibody
BBC3 antibody was raised in rabbit using the N terminal of BBC3 as the immunogenDegré de pureté :Min. 95%MMP1 antibody
The MMP1 antibody is a highly targeted molecule that plays a crucial role in various biological processes. This activated antibody acts as a neutralizing agent, specifically designed for Life Sciences applications. It has the ability to bind and inhibit the activity of matrix metalloproteinase 1 (MMP-1), an enzyme responsible for breaking down fibrinogen and other extracellular matrix proteins.STAT5A antibody
The STAT5A antibody is a test substance that specifically targets the glycoprotein STAT5A. This antibody is widely used in the field of medicine and life sciences to study the activation and function of STAT5A. It has been shown to be effective in various experimental setups, including Western blotting, immunohistochemistry, and flow cytometry.
CANX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CANX antibody, catalog no. 70R-9881Degré de pureté :Min. 95%EXOSC4 antibody
EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
CDKN2B antibody
CDKN2B antibody was raised in rabbit using the middle region of CDKN2B as the immunogenACCN5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACCN5 antibody, catalog no. 70R-1510Degré de pureté :Min. 95%FKHR antibody
FKHR antibody is a growth factor that acts as a protein kinase. This antibody specifically targets FKHR, which is involved in various cellular processes such as cell growth, proliferation, and survival. The effective dose of this monoclonal antibody has been determined through extensive research and testing. FKHR antibody has been shown to have a high affinity for fatty acids and can effectively inhibit the binding of these molecules to their respective receptors. Additionally, this antibody has demonstrated the ability to block the activity of epidermal growth factor and collagen, two key regulators of cell function. Polyclonal antibodies targeting FKHR have also been developed and can be used for diagnostic purposes. These antibodies are colloidal in nature and have shown excellent specificity and sensitivity when used in assays such as immunohistochemistry or ELISA. Furthermore, FKHR antibody has been found to modulate the expression of chemokines and transforming growth factor-beta (TGF-beta), suggesting its potential role in immune regulation and inflammation control.
Degré de pureté :Min. 95%CCDC96 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC96 antibody, catalog no. 70R-3730
Degré de pureté :Min. 95%LRRC33 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC33 antibody, catalog no. 70R-7519Degré de pureté :Min. 95%GluR1 antibody
The GluR1 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the GluR1 receptor, which plays a crucial role in mediating glutamate signaling in the brain. This antibody has been extensively tested and validated for its high specificity and sensitivity.EIF2S1 antibody
EIF2S1 antibody was raised using the C terminal of EIF2S1 corresponding to a region with amino acids RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAEDTransferrin Receptor protein (concentrate)
Native Human Transferrin Receptor concentrateDegré de pureté :Min. 95%EDIL3 antibody
EDIL3 antibody was raised in rabbit using the N terminal of EDIL3 as the immunogenDegré de pureté :Min. 95%SERPINH1 antibody
SERPINH1 antibody was raised in rabbit using the C terminal of SERPINH1 as the immunogenDegré de pureté :Min. 95%NRIP3 antibody
NRIP3 antibody was raised in rabbit using the middle region of NRIP3 as the immunogenDegré de pureté :Min. 95%BRUNOL6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BRUNOL6 antibody, catalog no. 70R-4726Degré de pureté :Min. 95%Influenza A antibody (H3N2) (HRP)
Influenza A antibody (H3N2) (HRP) was raised in goat using Influenza A, strain Texas 1/77 (H3N2) as the immunogen.BHMT antibody
BHMT antibody was raised using the N terminal of BHMT corresponding to a region with amino acids AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
LYN antibody
LYN antibody was raised in Mouse using a purified recombinant fragment of LYN expressed in E. coli as the immunogen.PDK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.Degré de pureté :Min. 95%GSTK1 antibody
GSTK1 antibody was raised using the middle region of GSTK1 corresponding to a region with amino acids NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLCD61 antibody
The CD61 antibody is a highly specialized antibody-drug that belongs to the class of antibodies known as polyclonal antibodies. It is specifically designed to target a specific antigen, known as CD61, which plays a crucial role in various biological processes including chemokine signaling and immune response. This antibody is widely used in research and diagnostic applications such as immunohistochemistry and flow cytometry.
SLC7A11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A11 antibody, catalog no. 70R-6800Degré de pureté :Min. 95%CD137L-muCD8 Fusion protein
Purified recombinant Human CD137L-muCD8 Fusion protein
Degré de pureté :Min. 95%SH3BGRL antibody
SH3BGRL antibody was raised using the middle region of SH3BGRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQAMyc antibody
The Myc antibody is a polyclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It is commonly used in life sciences research for applications such as immunoassays, immunohistochemistry, and western blotting. This antibody has high affinity and specificity for EGFR, making it an ideal tool for studying the role of this receptor in various biological processes.Degré de pureté :Min. 95%EFCAB3 antibody
EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAOBOX6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OBOX6 antibody, catalog no. 20R-1165Degré de pureté :Min. 95%
