Produits biochimiques et réactifs

A synthetic peptide for use as a blocking control in assays to test for specificity of PCMTD1 antibody, catalog no. 70R-1075

A synthetic peptide for use as a blocking control in assays to test for specificity of PAOX antibody, catalog no. 70R-3320

Purified recombinant SOCS3 protein (His tag)

Rabbit polyclonal ABHD11 antibody

Clostridium difficile Toxin A Monoclonal Antibody

Notch 2 homolog antibody was raised in rabbit using a synthetic peptide representing the C terminal region of the human NOTCH homolog 2 (NOTCH2) protein as the immunogen.

Rabbit polyclonal Tumor necrosis factor antibody (HRP)

The ANXA3 antibody is a monoclonal antibody that specifically targets annexin A3, a protein involved in various cellular processes. This antibody is widely used in the field of Life Sciences for research purposes. Annexin A3 has been shown to have a matrix effect on collagen and can form an antibody complex with other proteins. The ANXA3 antibody is produced by a hybridoma cell strain, which ensures its high specificity and affinity for its target. Researchers often use this antibody to study the role of annexin A3 in mitogen-activated protein (MAP) kinase signaling pathways and endothelial cell proliferation. Additionally, the ANXA3 antibody can be conjugated to magnetic particles or used in combination with inhibitors to further enhance its applications in various experimental techniques.

Rabbit polyclonal SLC17A5 antibody

DDX55 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK

Purified recombinant CKMM Type 1 protein

The CHRM2 antibody is a highly specialized medicament that belongs to the class of Polyclonal Antibodies. It serves as a serum marker for the detection and diagnosis of various conditions related to acetylcholine signaling. This antibody specifically targets the CHRM2 receptor, which plays a crucial role in mediating the effects of acetylcholine in the body.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF560 antibody, catalog no. 70R-8135

The Caveolin antibody is a neutralizing protein that plays a crucial role in various cellular processes. It specifically targets glucose-6-phosphate, p53 protein, and growth factors involved in Life Sciences. This monoclonal antibody has been extensively studied and proven to effectively bind to glycopeptides and other glycosylated proteins. Additionally, it has shown promising results in inhibiting the activity of epidermal growth factor and collagen-related pathways.

N6AMT2 antibody was raised in Rabbit using Human N6AMT2 as the immunogen

ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE

This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.

The ATM antibody is a polyclonal antibody that is used in life sciences research to study microvessel density and angiogenesis. It specifically targets the ATM protein, which plays a crucial role in DNA repair and cell cycle control. The ATM antibody can be used to detect the expression of ATM in various tissues and cell types. It has been shown to have high specificity and sensitivity, making it a valuable tool for researchers studying the role of ATM in cancer, cardiovascular diseases, and other disorders. Additionally, the ATM antibody has potential applications in antiangiogenic therapy, as it can inhibit the growth of new blood vessels by targeting specific molecules involved in angiogenesis. With its high-quality production and reliable performance, the ATM antibody is an essential tool for any researcher working in the field of molecular biology or biomedicine.

Rabbit polyclonal UGT3A1 antibody

RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH

CCDC63 antibody was raised using the middle region of CCDC63 corresponding to a region with amino acids EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS

Purified Rabbit polyclonal MYF5 antibody (Ser49)

LIN9 antibody was raised in rabbit using the N terminal of LIN9 as the immunogen

Chicken anti Goat IgG secondary antibody (HRP)

The TRIM31 antibody is a polyclonal antibody that specifically targets insulin. It is widely used in the field of life sciences for its ability to neutralize insulin and study its effects on various biological processes. This antibody can be used in experiments involving acetyltransferase activity, as well as in studies investigating the interaction between insulin and other proteins such as E-cadherin, β-catenin, fibronectin, collagen, and more. The TRIM31 antibody has also been shown to have cytotoxic effects on certain cells, making it a valuable tool for researchers studying autoimmune diseases and the role of autoantibodies. With its high specificity and versatility, this antibody is an essential component of any laboratory studying insulin-related processes.

WNT2B antibody was raised using the N terminal of WNT2B corresponding to a region with amino acids MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL

Rabbit polyclonal ARHGEF18 antibody (FITC)

Mouse monoclonal ADH1B antibody

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

Rabbit Polyclonal EGFR antibody (Tyr1197)

Mouse monoclonal CD8 antibody (biotin); target human; IgG1 kappa; 20 ul (0.25 ug)/test

The RPL8 antibody is a highly effective inhibitor that belongs to the class of antibodies. It is widely used in Life Sciences for various applications, including the study of interleukin and adeno-associated viruses. This antibody has been extensively tested and proven to be highly specific, making it an ideal tool for researchers in the field. With its high affinity and exceptional binding capabilities, the RPL8 antibody can be used as an affinity ligand to isolate and purify target proteins from complex mixtures. Additionally, this antibody has shown promising results as a potential medicament, with its ability to target autoantibodies and provide therapeutic benefits. Whether you are working on extracellular studies or isolated retinal experiments, the RPL8 antibody is a valuable asset that can greatly enhance your research outcomes.

PAR1 antibody was raised in Mouse using a purified recombinant fragment of PAR1 expressed in E. coli as the immunogen.

SLC38A1 antibody was raised using the middle region of SLC38A1 corresponding to a region with amino acids DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD

Sheep polyclonal Estriol 6 antibody

Purified recombinant DKK1 protein (His tag)

ZNF485 antibody was raised in rabbit using the N terminal of ZNF485 as the immunogen

STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELK

A synthetic peptide for use as a blocking control in assays to test for specificity of GJB4 antibody, catalog no. 70R-1690

TMPRSS4 antibody was raised in rabbit using the N terminal of TMPRSS4 as the immunogen

Annexin A8-Like 2 antibody was raised using the middle region of ANXA8L2 corresponding to a region with amino acids VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYA

A synthetic peptide for use as a blocking control in assays to test for specificity of TGM4 antibody, catalog no. 70R-3924

LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG

The EFTUD2 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody targets c-myc, a protein involved in various cellular processes. It can be used for research purposes, such as studying the role of c-myc in insulin signaling or investigating its interaction with other proteins.

The CYP2C19 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to the CYP2C19 enzyme, which plays a crucial role in drug metabolism. By inhibiting the activity of this enzyme, the CYP2C19 antibody can have a significant impact on the effectiveness and safety of certain medications.

AK7 antibody was raised in rabbit using the C terminal of AK7 as the immunogen