Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.564 produits)
- Par Biological Target(101.024 produits)
- Par usage/effets pharmacologiques(6.952 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(531 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130609 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
hCG beta antibody
hCG beta antibody was raised in mouse using human chorionic gonadotropin beta as the immunogen.Plakophilin 2 antibody
Plakophilin 2 antibody was raised using the N terminal of PKP2 corresponding to a region with amino acids HPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPDegré de pureté :Min. 95%FBP1 protein
FBP1 protein is a key component in various biological processes and has been extensively studied in the field of Life Sciences. It plays a crucial role in DNA vaccine development, as it has been shown to induce a strong immune response against specific antigens. FBP1 protein also interacts with collagen and inhibitors, contributing to the maintenance of tissue integrity and preventing degradation by matrix metalloproteinases. Additionally, FBP1 protein is involved in carbonic anhydrase activity and has been targeted for therapeutic purposes using monoclonal antibodies such as adalimumab. Its unique structure, consisting of amino acid residues, allows for precise binding to target molecules and efficient modulation of biological pathways. The use of FBP1 protein holds great promise in various research areas, including biomaterials, drug delivery systems, and diagnostics.Degré de pureté :Min. 95%C10ORF96 antibody
C10ORF96 antibody was raised using the middle region of C10Orf96 corresponding to a region with amino acids QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKENCRNA00114 antibody
NCRNA00114 antibody was raised using the N terminal Of Ncrna00114 corresponding to a region with amino acids SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLTPSMA4 antibody
The PSMA4 antibody is a highly specific monoclonal antibody that targets the proteasome subunit alpha type-4 (PSMA4). PSMA4 plays a crucial role in protein degradation and is involved in various cellular processes. This antibody recognizes specific epitopes on PSMA4 and can be used for research purposes, such as Western blotting, immunoprecipitation, and immunofluorescence.TRPC4 antibody
The TRPC4 antibody is a monoclonal antibody that specifically targets and binds to the TRPC4 protein. This protein plays a crucial role in various cellular processes, including calcium signaling and ion channel regulation. By binding to TRPC4, this antibody can modulate its activity and function.JAK2 antibody
The JAK2 antibody is a highly specific and reliable tool used in Life Sciences research. It is an antigen that targets autoantibodies and can be used for various applications. This antibody, whether polyclonal or monoclonal, binds to the nuclear protein JAK2, allowing for the detection and analysis of JAK2 expression in cells and tissues.FOXO3A antibody
The FOXO3A antibody is a high-quality polyclonal antibody used in Life Sciences. It specifically targets the mineralocorticoid receptor and has antiviral properties. This antibody is produced using excipients and globulin, ensuring its purity and effectiveness. It acts as an antigen, binding to specific proteins and neutralizing their activity. The FOXO3A antibody can be used as a medicament in various applications, including research and diagnostics. Its low density allows for easy handling and accurate dosing. Additionally, this antibody has been shown to inhibit the growth of certain factors that promote cell proliferation, making it a valuable tool in studying cellular processes. Autoantibodies against FOXO3A have also been identified, highlighting its significance in immune responses. Choose the FOXO3A antibody for reliable results and precise targeting of protein complexes.C1QB antibody
C1QB antibody was raised using the middle region of C1QB corresponding to a region with amino acids PGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPR
Degré de pureté :Min. 95%Growth Hormone 2 antibody
Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG
Degré de pureté :Min. 95%Keratin Type II antibody
Keratin Type II antibody was raised in mouse using human epidermal keratin as the immunogen.ACTA1 antibody
The ACTA1 antibody is a highly specialized monoclonal antibody that targets the ACTA1 protein. This protein is involved in muscle contraction and is essential for proper muscle function. The antibody specifically binds to the ACTA1 protein, preventing its interaction with other molecules and inhibiting muscle contraction.APOA1 protein
APOA1 protein is a versatile and potent anti-VEGF (vascular endothelial growth factor) agent that plays a crucial role in various Life Sciences applications. It acts as a chemokine inhibitory factor, neutralizing the effects of VEGF and other growth factors involved in angiogenesis. APOA1 protein is widely used in research and development to study the mechanisms of angiogenesis and to develop novel therapies for diseases such as cancer, diabetic retinopathy, and macular degeneration.Degré de pureté :Min. 95%IKBKE antibody
IKBKE antibody was raised in Mouse using a purified recombinant fragment of IKBKE(aa1-257) expressed in E. coli as the immunogen.
Rabbit Red Blood Cells
Rabbit Red Blood Cells are biospecimens that are commonly used in various research studies and laboratory experiments. These cells have unique characteristics that make them suitable for a wide range of applications. One of the key features of Rabbit Red Blood Cells is their ability to emit light when they undergo lysis. This property makes them ideal for use in assays that require the detection of cell lysis or membrane damage. Researchers can utilize this characteristic to study various cellular processes, such as apoptosis or cytotoxicity. Moreover, Rabbit Red Blood Cells can be used in the development and validation of diagnostic tests. They can serve as a matrix for the evaluation of drug candidates or the detection of specific biomarkers. For instance, these cells can be used to assess the hemolytic activity of drugs or antibodies. In addition, Rabbit Red Blood Cells are commonly employed in veterinary applications. They can be utilized in studies related to animal health and disease. For example, researchers may use these cells to investigate the effects of certain compoundsDegré de pureté :Min. 95%Park7 protein
Park7 protein is a multifunctional protein that plays a role in various biological processes. It is involved in the regulation of TGF-beta signaling, collagen synthesis, and cell survival. Park7 protein has been studied extensively in the field of Life Sciences, and monoclonal antibodies have been developed for its detection and analysis. Additionally, Park7 protein has been found to interact with carbon quantum dots, influenza hemagglutinin, oligodeoxynucleotides, and other molecules, suggesting its potential as a target for therapeutic interventions. Conjugated proteins containing Park7 protein have also shown promise as medicaments for various conditions. Furthermore, research has indicated that Park7 protein may play a role in chemokine signaling and adipose tissue metabolism. Overall, Park7 protein exhibits diverse functions and holds great potential for further exploration as a target for peptide agents or modulators of angiotensin-converting enzyme activity.
Degré de pureté :Min. 95%PAK3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication processes, thereby preventing bacterial growth. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.Symplekin antibody
Symplekin antibody was raised using the middle region of SYMPK corresponding to a region with amino acids GPLPKETAAGGLTLKEERSPQTLAPVGEDAMKTPSPAAEDAREPEAKGNSDegré de pureté :Min. 95%KLF4 antibody
KLF4 antibody was raised in Mouse using a purified recombinant fragment of human KLF4 expressed in E. coli as the immunogen.CRTC2 antibody
The CRTC2 antibody is a highly specialized antibody that targets the phosphatase activity of CRTC2, a protein kinase involved in various cellular processes. This antibody has antiviral properties and can neutralize the effects of TGF-beta, a key signaling molecule involved in cell growth and differentiation. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. The CRTC2 antibody has been extensively studied in the field of life sciences and has shown promising results in the activation of mesenchymal stem cells and modulation of P2X receptors. Additionally, this antibody has been found to have synergistic effects when combined with red ginseng, further enhancing its therapeutic potential.
KISS1 protein
1-120 amino acids: MEPLEKVASV GNSRPTGQQL ESLGLLAPGE QSLPCTERKP AATARLSRRG TSLSPPPESS GSPQQPGLSA PHSRQIPAPQ GAVLVQREKD LPNYNWNSFG LRFGKREAAP GNHGRSAGRGDegré de pureté :>90% By Sds-PageCobl-Like 1 antibody
Cobl-Like 1 antibody was raised using the middle region of COBLL1 corresponding to a region with amino acids QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLPFBXO39 antibody
FBXO39 antibody was raised using the middle region of FBXO39 corresponding to a region with amino acids RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSVLOC641765 antibody
LOC641765 antibody was raised in rabbit using the C terminal of LOC641765 as the immunogenDegré de pureté :Min. 95%ATM antibody
The ATM antibody is a highly versatile and powerful tool in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the ATM protein, which plays a crucial role in DNA repair and cell cycle regulation. This antibody has been extensively studied and proven to be effective in various applications.Degré de pureté :Min. 95%ASCC2 antibody
ASCC2 antibody was raised using the middle region of ASCC2 corresponding to a region with amino acids YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDDp44/42 MAP Kinase antibody (Phospho-Tyr204)
Rabbit Polyclonal p44/42 MAP Kinase antibody (Phospho-Tyr204)Lp-PLA2 monoclonal antibody
Lp-PLA2 monoclonal antibody is a highly specialized antibody that targets lipoprotein-associated phospholipase A2 (Lp-PLA2), an enzyme involved in the development of atherosclerosis. This monoclonal antibody has been extensively studied and shown to inhibit the activity of Lp-PLA2, leading to reduced inflammation and plaque formation in arteries.
