Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.015 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
HIV1 p24 antibody
HIV1 p24 antibody was raised in mouse using HIV1 p24 (native antigen) as the immunogen.PAPPA antibody
The PAPPA antibody is a cytotoxic monoclonal antibody that is used in immunoassays to detect and neutralize the activity of pregnancy-associated plasma protein A (PAPPA). PAPPA is an enzyme that cleaves insulin-like growth factor-binding proteins (IGFBPs), thereby releasing insulin-like growth factors (IGFs) and promoting cell proliferation. The PAPPA antibody specifically binds to PAPPA, preventing its interaction with IGFBPs and inhibiting its enzymatic activity. This antibody can be used in research and diagnostic applications to study the role of PAPPA in various biological processes, including fetal development, cancer progression, and cardiovascular diseases. With its high specificity and affinity for PAPPA, the monoclonal antibody provides reliable results in experiments involving the detection and quantification of this important biomarker.LIN28 antibody
The LIN28 antibody is a protein molecular inhibitor that targets the fatty acid transporter. It is a monoclonal antibody used in life sciences research and as a reagent for immunohistochemistry. This antibody specifically inhibits glutaminase, an enzyme involved in the metabolism of glutamine. By blocking the activity of glutaminase, the LIN28 antibody may have potential therapeutic applications as a chemotherapeutic agent. Its high specificity and affinity make it an ideal tool for studying the role of glutaminase in various cellular processes and diseases.RAC1 antibody
The RAC1 antibody is a highly specialized product used in Life Sciences research. It is an essential tool for studying various cellular processes, including adipose tissue development and human serum analysis. This antibody specifically targets the RAC1 protein, which plays a crucial role in cell signaling and cytoskeletal rearrangement.Degré de pureté :Min. 95%EXOSC7 antibody
EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVDALOXE3 antibody
The ALOXE3 antibody is a highly specialized antibody that targets the protein mesothelin. Mesothelin is a chemokine that plays a crucial role in various biological processes, including cell growth and migration. This antibody can be used in different research applications, such as immunohistochemistry and western blotting, to detect and quantify mesothelin levels in human serum or tissue samples.Tau antibody
The Tau antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It has the ability to interact with interferons and histidine residues, making it an essential component in immune responses. This antibody is produced through advanced techniques using hybridoma cells, ensuring its purity and effectiveness.Degré de pureté :Min. 95%Crystallin α B antibody
Crystallin Alpha B antibody was raised using the C terminal of CRYAB corresponding to a region with amino acids KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTSLC25A38 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A38 antibody, catalog no. 70R-6469Degré de pureté :Min. 95%HEYL antibody
HEYL antibody was raised in mouse using recombinant Human Hairy/Enhancer-Of-Split Related With Yrpw Motif-LikeSHH antibody
SHH antibody was raised in Mouse using a purified recombinant fragment of human SHH expressed in E. coli as the immunogen.
ARSH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARSH antibody, catalog no. 70R-6266Degré de pureté :Min. 95%OR2H2 antibody
OR2H2 antibody was raised in rabbit using the C terminal of OR2H2 as the immunogenDegré de pureté :Min. 95%P2RX2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5145Degré de pureté :Min. 95%Tubulin beta antibody
The Tubulin beta antibody is a highly effective neutralizing agent that targets the carbonic region of the tubulin beta protein. This monoclonal antibody has been specifically designed to bind to and inhibit the activity of tubulin beta, which plays a crucial role in cell division and growth. By blocking the function of tubulin beta, this antibody prevents the formation of microtubules, which are essential for cellular processes such as mitosis and intracellular transport.COL4A2 antibody
The COL4A2 antibody is an inhibitory factor that targets chemokines and plays a crucial role in various biological processes. This monoclonal antibody specifically binds to annexin A2, a protein involved in cell adhesion and signal transduction. By neutralizing the activity of annexin A2, the COL4A2 antibody can inhibit the migration and invasion of cancer cells. Additionally, this antibody has been shown to have natriuretic effects, promoting diuresis and reducing blood pressure. In Life Sciences research, the COL4A2 antibody is commonly used as a tool to study autoantibodies and their role in disease development. Whether you need a monoclonal or polyclonal antibody, the COL4A2 antibody is an essential reagent for studying activated pathways and investigating potential therapeutic targets.APC antibody
The APC antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It has been extensively studied for its ability to interact with alpha-synuclein, a protein associated with neurodegenerative disorders such as Parkinson's disease. This antibody specifically targets and binds to tyrosine residues on alpha-synuclein, inhibiting its aggregation and promoting its clearance from the brain.PRDX2 antibody
PRDX2 antibody was raised using the middle region of PRDX2 corresponding to a region with amino acids VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDNFH antibody
NFH antibody was raised in rabbit using repeated motif, XKSPYK domain [SPEKAKSPEKAKSC] of NFH as the immunogen.Degré de pureté :Min. 95%DPP4 antibody
DPP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%ZNF474 antibody
ZNF474 antibody was raised in rabbit using the middle region of ZNF474 as the immunogenDegré de pureté :Min. 95%PRD antibody
PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRLNUDT16L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT16L1 antibody, catalog no. 70R-8788Degré de pureté :Min. 95%eIF4G antibody
The eIF4G antibody is a reactive monoclonal antibody that specifically targets the cysteine-rich protein eIF4G. This protein is activated in response to chemokines and plays a crucial role in various cellular processes related to Life Sciences. The eIF4G antibody has been extensively studied and shown to inhibit transmembrane conductance, human chemokine signaling pathways, and annexin activity. It is a valuable tool for researchers studying the function of eIF4G and its interactions with other proteins such as TNF-α and growth factors. Additionally, this monoclonal antibody can be used in assays involving phosphatase activity or as a cytotoxic agent in certain experimental setups. Trust the eIF4G antibody to provide accurate and reliable results in your research endeavors.
Degré de pureté :Min. 95%CDK2 antibody
The CDK2 antibody is an essential tool in the field of Life Sciences. It is an antigen that has antiviral properties and can be used to neutralize harmful viruses. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.
TRAF7 antibody
TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPRDegré de pureté :Min. 95%GTPBP2 antibody
GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEHArsg antibody
Arsg antibody was raised in rabbit using the C terminal of Arsg as the immunogenDegré de pureté :Min. 95%Keratin K18 antibody
Keratin K18 antibody was raised in Guinea Pig using Acidic human keratin K18 as the immunogen.Degré de pureté :Min. 95%CD15 antibody
CD15 antibody is a monoclonal antibody that targets the CD15 antigen, also known as Lewis X. It has been shown to have anti-tumor activity by inhibiting endothelial growth and inducing apoptosis in cancer cells. CD15 antibody can also be used in combination with other antibodies, such as anti-CD33 antibody or tyrosine kinase inhibitors, to enhance its cytotoxic effects. Additionally, CD15 antibody has shown neutralizing activity against vascular endothelial growth factor (VEGF) and tumor necrosis factor-alpha (TNF-α), which are important factors in promoting tumor growth and inflammation. This antibody has demonstrated efficacy in various cancer models, including MCF-7 breast cancer cells and circumsporozoite protein-expressing tumors. Its potential therapeutic applications make CD15 antibody a promising candidate for targeted cancer therapy.TSH antibody (Prediluted for IHC)
Mouse monoclonal TSH antibody (Prediluted for IHC)
Degré de pureté :Min. 95%gp91 phox antibody
The gp91 phox antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is commonly used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. This antibody specifically targets the gp91 phox protein, which plays a crucial role in the production of reactive oxygen species (ROS) by neutrophils and other phagocytic cells. By binding to the gp91 phox protein, this antibody can neutralize its activity and prevent ROS production. This makes it an essential tool for studying the role of ROS in various biological processes, including inflammation, oxidative stress, and immune responses. Additionally, this antibody has been validated for use in human serum samples and has shown high affinity and specificity for its target antigen. Whether you are conducting basic research or developing diagnostic assays, the gp91 phox antibody is an invaluable tool that can provide valuable insights into cellular processes and disease mechanisms.
