Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.557 produits)
- Par Biological Target(101.014 produits)
- Par usage/effets pharmacologiques(6.941 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(530 produits)
- Biologie végétale(6.903 produits)
- Métabolites secondaires(14.369 produits)
130563 produits trouvés pour "Produits biochimiques et réactifs"
CAMK2B antibody
CAMK2B antibody was raised in rabbit using the middle region of CAMK2B as the immunogenGNPTAB antibody
GNPTAB antibody was raised in rabbit using the N terminal of GNPTAB as the immunogen
Degré de pureté :Min. 95%IgG1 Isotype Control Fc fusion protein (biotin)
Rat monoclonal IgG1 Isotype Control Fc fusion protein (biotin)
Degré de pureté :Min. 95%TMEM30B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM30B antibody, catalog no. 70R-6444Degré de pureté :Min. 95%FGFR5 antibody
The FGFR5 antibody is a monoclonal antibody that specifically targets the human protein involved in hepatocellular carcinomas. It is widely used in Life Sciences research to study the growth factors and signaling pathways associated with cancer development. This antibody is produced by hybridoma cells, which are created by fusing antibody-producing B cells with myeloma cells. The hybridoma cell line secretes large quantities of this specific antibody, allowing for its isolation and purification. The FGFR5 antibody can be used in various biochemical assays to detect and quantify the presence of its target antigen. It is also a valuable tool for developing new therapeutic strategies and antibacterial agents targeting FGFR5. Scientists and researchers rely on this high-quality monoclonal antibody to advance their understanding of cancer biology and develop innovative treatments.
Leptin antibody
Leptin antibody was raised in mouse using highly pure recombinant human leptin as the immunogen.ZNF276 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF276 antibody, catalog no. 70R-8119Degré de pureté :Min. 95%Rhebl1 antibody
Rhebl1 antibody was raised in rabbit using the N terminal of Rhebl1 as the immunogenDegré de pureté :Min. 95%FKBPL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FKBPL antibody, catalog no. 70R-3368Degré de pureté :Min. 95%MGC29891 antibody
MGC29891 antibody was raised in rabbit using the C terminal of MGC29891 as the immunogenDegré de pureté :Min. 95%EIF4G3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4G3 antibody, catalog no. 70R-4940Degré de pureté :Min. 95%OAZ3 antibody
OAZ3 antibody was raised in rabbit using the middle region of OAZ3 as the immunogenDegré de pureté :Min. 95%RAB5A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB5A antibody, catalog no. 70R-5861
Degré de pureté :Min. 95%CK1 γ 2 antibody
CK1 gamma 2 antibody was raised using the N terminal of CSNK1G2 corresponding to a region with amino acids FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKGCDH antibody
GCDH antibody was raised using the C terminal of GCDH corresponding to a region with amino acids IARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITG
hCG_1982709 antibody
hCG_1982709 antibody was raised in rabbit using the N terminal of HCG_1982709 as the immunogenDegré de pureté :Min. 95%MPG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MPG antibody, catalog no. 70R-6638Degré de pureté :Min. 95%Ezrin antibody
The Ezrin antibody is a highly specific monoclonal antibody that targets ezrin, a protein involved in cell adhesion and signaling. It has been shown to have high specific activity in neutralizing the function of ezrin. This antibody can be used in various applications in the Life Sciences field, including research on alpha-fetoprotein and annexin A2. It is also effective in inhibiting the production of superoxide, a reactive oxygen species involved in oxidative stress. The Ezrin antibody can be used as a valuable tool for studying cell biology and investigating the role of ezrin in various cellular processes.
UBXD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBXD2 antibody, catalog no. 20R-1265Degré de pureté :Min. 95%SPR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPR antibody, catalog no. 70R-9834Degré de pureté :Min. 95%Prolactin protein (> 98% pure)
Purified native Human Prolactin protein (> 98% pure)Degré de pureté :Purity ≥98% Pure By Sds-Page.R spondin1 antibody
R spondin1 antibody was raised in Mouse using a purified recombinant fragment of RSPO1 expressed in E. coli as the immunogen.Keratin 5 antibody
The Keratin 5 antibody is a powerful tool for researchers in the field of Life Sciences. It is a monoclonal antibody that specifically targets Keratin 5, a protein found in mesenchymal stem cells. This antibody can be used to study the growth factor emission and differentiation of these cells. It has been extensively validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry.
TOX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TOX antibody, catalog no. 70R-8006Degré de pureté :Min. 95%RPS14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPS14 antibody, catalog no. 70R-1391Degré de pureté :Min. 95%BIM antibody
The BIM antibody is a highly specialized product used in the field of Life Sciences. It is particularly useful in the study of mucopolysaccharidosis type and its effects on human serum. This antibody has the unique ability to immobilize oncostatin, a cysteine disulfide that plays a crucial role in messenger RNA regulation. The BIM antibody is available in both polyclonal and monoclonal forms, giving researchers flexibility in their experiments. With its acidic properties, this antibody acts as an inhibitory factor, allowing scientists to explore various pathways and processes with precision. It can be used in conjunction with electrodes and natriuretic agents for further analysis. The BIM antibody is an essential tool for those seeking to delve deeper into the intricate workings of the human body and advance our understanding of complex diseases.Degré de pureté :Min. 95%STAT6 antibody
The STAT6 antibody is a highly effective tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and binds to the STAT6 protein, which plays a crucial role in cell signaling pathways. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.Degré de pureté :Min. 95%UCK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UCK1 antibody, catalog no. 70R-10374Degré de pureté :Min. 95%
