Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.572 produits)
- Par Biological Target(100.755 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(467 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130507 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
GBA protein
GBA protein is a monoclonal antibody that has neutralizing properties against various colony-stimulating factors, chemokines, and interleukin-6. It is a glycopeptide that specifically targets the CXCR4 receptor and inhibits its activity. GBA protein also has an affinity for epidermal growth factor and basic protein, further enhancing its therapeutic potential. Additionally, it has been shown to inhibit the production of tumor necrosis factor-alpha (TNF-α) and granulocyte-macrophage colony-stimulating factor (GM-CSF). GBA protein is widely used in the field of Life Sciences as a tool for studying cellular signaling pathways and as a conjugated protein for targeted drug delivery. Its effectiveness and specificity make it a valuable asset in various research applications.Degré de pureté :Min. 95%GATA1 antibody
GATA1 antibody was raised in Mouse using a purified recombinant fragment of human GATA1 expressed in E. coli as the immunogen.DSG4 antibody
Recombinant peptide of extracellular repeat domain E4; aa 472-590 of human Desmoglein 3Degré de pureté :Min. 95%ZZZ3 antibody
ZZZ3 antibody was raised in rabbit using the middle region of ZZZ3 as the immunogenDegré de pureté :Min. 95%F7 antibody
F7 antibody was raised in rabbit using the middle region of F7 as the immunogen
Degré de pureté :Min. 95%ELAC1 protein
The ELAC1 protein is a target for monoclonal antibodies in various research applications. It can be used for hybridization studies, as well as in the detection and quantification of ELAC1 protein levels in samples such as human serum. The ELAC1 protein can also be conjugated with other proteins or molecules, such as streptavidin, to facilitate specific binding and detection. In addition, it has been shown to interact with other molecules like cefmetazole, cefotiam, interferon, anhydrous sodium, hydrochloric acid, and chemokines. This versatile protein plays a crucial role in various biological processes and is widely used in life sciences research.Degré de pureté :Min. 95%KCNJ8 antibody
KCNJ8 antibody was raised using the middle region of KCNJ8 corresponding to a region with amino acids EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKHDAC6 antibody
The HDAC6 antibody is a highly effective medicament that targets adipose tissues and adipocytes. This monoclonal antibody specifically binds to glial fibrillary acidic protein, neutralizing its receptor binding capabilities. By doing so, it prevents the activation of reactive fatty acids and inhibits the formation of activated adipocytes. Additionally, this antibody has shown promising results in reducing glial fibrillary acidic protein levels in various life science studies. With its anti-glial fibrillary properties, the HDAC6 antibody holds great potential in the field of adipose research and therapeutic applications.GABARAP protein (His tag)
1-117 amino acids: MGSSHHHHHH SSGLVPRGSH MKFVYKEEHP FEKRRSEGEK IRKKYPDRVP VIVEKAPKAR IGDLDKKKYL VPSDLTVGQF YFLIRKRIHL RAEDALFFFV NNVIPPTSAT MGQLYQEHHE EDFFLYIAYS DESVYGLDegré de pureté :Min. 95%NFYC Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NFYC antibody, catalog no. 70R-8307Degré de pureté :Min. 95%CDX2 antibody
The CDX2 antibody is a polyclonal antibody that is commonly used in Life Sciences research. It is highly specific and has been extensively validated for various applications. This antibody targets the CDX2 protein, which plays a crucial role in regulating gene expression and cell differentiation.Collagen Type I α 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of COL1A2 antibody, catalog no. 70R-5422Degré de pureté :Min. 95%CYB5D1 antibody
CYB5D1 antibody was raised using the middle region of CYB5D1 corresponding to a region with amino acids KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTELWIPI1 antibody
WIPI1 antibody was raised using the N terminal of WIPI1 corresponding to a region with amino acids AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN
Dihydrotestosterone antibody
The Dihydrotestosterone antibody is an anti-connexin agent that is used in Life Sciences research. It is a monoclonal antibody that specifically targets dihydrotestosterone, a hydrogen atom variant of testosterone. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications. It can be used in techniques such as particle chemiluminescence and electrode-based assays to detect and quantify dihydrotestosterone levels. Additionally, this antibody has shown potential for use in studying the role of dihydrotestosterone in various biological processes, including helicobacter infection and TGF-beta signaling pathways. With its high affinity and specificity, the Dihydrotestosterone antibody is a valuable tool for researchers studying hormone-related disorders and exploring new therapeutic strategies.Degré de pureté :Min. 95%FTHL17 antibody
FTHL17 antibody was raised using the N terminal of FTHL17 corresponding to a region with amino acids MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIRDegré de pureté :Min. 95%RAB2B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB2B antibody, catalog no. 70R-10148Degré de pureté :Min. 95%RRAGC antibody
RRAGC antibody was raised in mouse using recombinant Human Ras-Related Gtp Binding C (Rragc)IFT172 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IFT172 antibody, catalog no. 70R-9095
Degré de pureté :Min. 95%HSP27 antibody
The HSP27 antibody is a highly specific monoclonal antibody that targets the HSP27 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and shown to be effective in detecting HSP27 in different biological samples, including human serum and tissue sections.DACH2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DACH2 antibody, catalog no. 70R-7920Degré de pureté :Min. 95%EGR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EGR1 antibody, catalog no. 70R-2040Degré de pureté :Min. 95%SHROOM2 antibody
SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTMCD62E antibody
The CD62E antibody is a highly specialized monoclonal antibody that is used in various Life Sciences assays. It specifically targets and binds to the CD62E molecule, also known as E-selectin, which is a cell adhesion molecule involved in inflammation and immune responses. This antibody is buffered and formulated with collagen-coated microparticles for enhanced stability and performance. The CD62E antibody can be used in combination with other antibodies or reagents to study the expression and function of CD62E in different biological samples, including human serum. Its high specificity and sensitivity make it an essential tool for researchers studying various aspects of cell adhesion, inflammation, and immune system regulation.CTDSPL antibody
CTDSPL antibody was raised using a synthetic peptide corresponding to a region with amino acids CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
KIF3B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIF3B antibody, catalog no. 70R-5560Degré de pureté :Min. 95%ZNF606 antibody
ZNF606 antibody was raised in rabbit using the N terminal of ZNF606 as the immunogenDegré de pureté :Min. 95%AK3 antibody
The AK3 antibody is a highly specialized biomolecule that falls under the category of antibodies in the field of Life Sciences. It possesses unique properties that make it an essential tool for various applications. This monoclonal antibody has been proven to exhibit neutralizing effects against interferons, which are crucial in immune responses and antiviral defense mechanisms.SLC34A3 antibody
SLC34A3 antibody was raised in rabbit using the middle region of SLC34A3 as the immunogen
Degré de pureté :Min. 95%UBE3B antibody
UBE3B antibody was raised using the middle region of UBE3B corresponding to a region with amino acids VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE
