Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.575 produits)
- Par Biological Target(100.728 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(440 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130509 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
PIP3-E antibody
PIP3-E antibody was raised using the C terminal of PIP3-E corresponding to a region with amino acids DDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSSTNFRII antibody
TNFRII antibody was raised in Mouse using recombinant soluble human TNFRII-Fc fusion protein as the immunogen.
EPHX1 antibody
EPHX1 antibody was raised in mouse using recombinant human EPHX1 (21-455aa) purified from E. coli as the immunogen.NPHP1 antibody
NPHP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGDegré de pureté :Min. 95%MLPH antibody
MLPH antibody was raised in rabbit using the C terminal of MLPH as the immunogenDegré de pureté :Min. 95%FHL1 antibody
The FHL1 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets FHL1, a protein involved in various biological processes. This antibody has been extensively studied and proven to have high specificity and sensitivity in detecting FHL1 in human serum and tissue samples.Angel1 antibody
Angel1 antibody was raised in rabbit using the C terminal of Angel1 as the immunogen
Degré de pureté :Min. 95%ABCG1 antibody
The ABCG1 antibody is a monoclonal antibody that specifically targets the ABCG1 protein, which is involved in the regulation of cholesterol metabolism. This antibody has been shown to inhibit the activity of ABCG1 and reduce cholesterol efflux from adipose tissue. It can also be used in assays to detect the presence of ABCG1 in human serum or other samples. The ABCG1 antibody has cytotoxic effects on cells expressing high levels of the target molecule and may be useful for therapeutic applications in diseases related to cholesterol metabolism, such as atherosclerosis. Additionally, this antibody can be used in research and development within the field of Life Sciences, particularly in studies involving collagen and urokinase plasminogen activator.GRIA2 antibody
GRIA2 antibody was raised in rabbit using the N terminal of GRIA2 as the immunogenDegré de pureté :Min. 95%ADAM30 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM30 antibody, catalog no. 70R-7288Degré de pureté :Min. 95%Rabbit anti Bovine IgG (rhodamine)
Rabbit anti-bovine IgG (Rhodamine) was raised in rabbit using bovine IgG F(ab')2 fragment as the immunogen.Degré de pureté :Min. 95%METTL2B antibody
METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAEArd1b antibody
Ard1b antibody was raised in rabbit using the middle region of Ard1b as the immunogenDegré de pureté :Min. 95%CHAC2 antibody
CHAC2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVPPIH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPIH antibody, catalog no. 70R-3818Degré de pureté :Min. 95%IL5 antibody
The IL5 antibody is a powerful tool in the field of immunology. It specifically targets and neutralizes interleukin-5 (IL-5), a chemokine that plays a crucial role in allergic and inflammatory responses. The IL5 antibody works by binding to IL-5, preventing it from interacting with its receptors and initiating downstream signaling pathways.C18ORF10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C18orf10 antibody, catalog no. 70R-4241Degré de pureté :Min. 95%RUNX2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RUNX2 antibody, catalog no. 70R-1010Degré de pureté :Min. 95%ZNF138 antibody
ZNF138 antibody was raised in rabbit using the C terminal of ZNF138 as the immunogenDegré de pureté :Min. 95%UXS1 antibody
UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHDegré de pureté :Min. 95%SP1 antibody
SP1 antibody was raised in rabbit using the middle region of SP1 as the immunogenDegré de pureté :Min. 95%Human Serum Albumin antibody
The Human Serum Albumin antibody is a monoclonal antibody that specifically targets and neutralizes hyaluronidase, TGF-beta, and collagen. This antibody is highly effective in inhibiting the activity of these enzymes and proteins, which are involved in various biological processes such as tissue remodeling and angiogenesis. Additionally, the Human Serum Albumin antibody has been shown to reduce microvessel density and inhibit the growth of tumors by blocking the EGF-like domain of human serum albumin. With its high affinity for histidine residues, this antibody offers a powerful tool for researchers studying epidermal growth factor signaling pathways and related cellular processes.PARP antibody
The PARP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in detecting and studying the function of poly(ADP-ribose) polymerase (PARP), an enzyme involved in DNA repair and cell death pathways. This antibody specifically targets PARP, allowing for precise detection and analysis of its activity.
