Produits biochimiques et réactifs
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.574 produits)
- Par Biological Target(100.660 produits)
- Par usage/effets pharmacologiques(6.934 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(362 produits)
- Biologie végétale(6.908 produits)
- Métabolites secondaires(14.364 produits)
130473 produits trouvés pour "Produits biochimiques et réactifs"
Human IgG Fab'2
Purified Human IgG Fab'2 for use as a control or blocking reagentDegré de pureté :Min. 95%Auh antibody
Auh antibody was raised in rabbit using the N terminal of Auh as the immunogenDegré de pureté :Min. 95%Neritaloside
CAS :Neritaloside is a cardiac glycoside that is classified as a depressant. It is used in the treatment of congestive heart failure and cardiac arrhythmias. Neritaloside has been shown to have neuroprotective effects, which may be due to its ability to inhibit reactive oxygen species and prevent DNA damage. Neritaloside also has been shown to have genotoxic effects, which can lead to cancer. Neritaloside binds to the α subunit of the adenosine receptor and inhibits protein synthesis, leading to cell death by inhibiting protein production vital for cell division. This drug also possesses some anticancer activity, which may be due to its ability to induce apoptosis in cultured cells.
Formule :C32H48O10Degré de pureté :Min. 95%Masse moléculaire :592.7 g/molN-Desboc docetaxel-d5
CAS :N-Desboc docetaxel-d5 is a deuterated analog of the chemotherapy drug docetaxel, which is derived from the diterpenoid taxane with a substitution at isotopic positions. This compound is synthesized to enhance the stability and traceability of docetaxel in biological systems during pharmacokinetic and metabolic studies. Its mode of action involves the inhibition of microtubule depolymerization, thus disrupting cell division and leading to apoptosis in rapidly dividing cancer cells.Formule :C38H45NO12Degré de pureté :Min. 95%Masse moléculaire :707.8 g/molBX471
CAS :BX471 is an antibody that binds to the extracellular domain of human alpha-1-adrenergic receptor. It is a research tool that can be used in the study of protein interactions, receptor activation and ion channel function. BX471 has been shown to inhibit the binding of ligands, such as peptides and drugs, to receptors. It also inhibits the activity of enzymes called tyrosine kinases and may be used as a pharmacological agent for treating cancer and other diseases.Formule :C21H24ClFN4O3Degré de pureté :Min. 95%Masse moléculaire :434.89 g/molSDZ WAG 994
CAS :SDZ WAG 994 is an experimental drug that has been shown to reduce the incidence of diabetic cardiomyopathy. It is a small molecule with a molecular weight of 514.3 Da and an adenosine receptor agonist activity. SDZ WAG 994 binds to adenosine receptors, which are found in the heart and brain. These receptors are involved in locomotion, pain sensation, and cardiac function. The binding of SDZ WAG 994 to these receptors leads to increased levels of cAMP, which is necessary for cell growth and proliferation. In addition, SDZ WAG 994 has been shown to have anti-inflammatory properties that may be useful in treating chronic pain caused by damaged tissue. SDZ WAG 994 was evaluated as a treatment for ventricular dysfunction in patients with type 2 diabetes mellitus (T2DM) using a randomized controlled trial design in which subjects were given either placebo or 50 mg/day of SDZ WAG 9Formule :C17H25N5O4Degré de pureté :Min. 95%Masse moléculaire :363.41 g/mol12:0 Lyso NBD pc
CAS :12:0 Lyso NBD PC is a fluorescent lipid probe, which is an analog of lysophosphatidylcholine. This synthetic product is derived from phospholipids modified with a NBD (7-nitro-2-1,3-benzoxadiazol-4-yl) fluorophore. Its primary manner of action involves integration into cellular membranes, where it enhances the visualization of lipid domains and membrane trafficking through fluorescence microscopy or flow cytometry.
Formule :C26H44N5O10PDegré de pureté :Min. 95%Masse moléculaire :617.63 g/molMAL-dPEG®4-Lys(-5(6)-Carboxyfluorescein)-NH-m-dPEG®24
MAL-dPEG®4-Lys(-5(6)-Carboxyfluorescein)-NH-m-dPEG®24 is a PEG compound containing a fluorescein dye used for tagging biomolecules, and serving as fluorescent probe for bioimaging applications.Formule :C94H149N5O39Degré de pureté :Min. 95%Masse moléculaire :1,973.2 g/molGSK837149A
CAS :GSK837149A is a potent inhibitor of the protein target that inhibits the growth of cancer cells. GSK837149A binds to the ATP-binding site in the ATPase domain of the protein target, preventing ATP hydrolysis and inhibiting cancer cell growth. This drug is selective for tumours with a m2 phenotype and has been shown to inhibit autophagy in colorectal adenocarcinoma cells. GSK837149A also has anti-inflammatory properties, which may be due to its ability to inhibit metabolism in cancer tissues.Formule :C23H22N8O5S2Degré de pureté :Min. 95%Masse moléculaire :554.6 g/molVeledimex
CAS :Veledimex is an inducible transcriptional activator, which is synthetically derived. It operates by modulating gene expression through a regulated system that requires the presence of its specific ligand. The product utilizes a small molecule called a chemical inducer of dimerization. Upon binding, it triggers the activator to dimerize, thus initiating transcription of the target gene. This mode of action allows for precise control over gene expression, offering a controlled system to study gene functions and recombinant protein production.
Formule :C27H38N2O3Degré de pureté :Min. 95%Masse moléculaire :438.6 g/molTTC8 antibody
TTC8 antibody was raised using the N terminal of TTC8 corresponding to a region with amino acids ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRBBP7 antibody
The RBBP7 antibody is a high-flux monoclonal antibody that is used in Life Sciences for various applications. It is commonly used as a serum marker and has antiviral properties. This antibody specifically targets RBBP7, an important protein involved in gene regulation and chromatin remodeling. By binding to RBBP7, this antibody can modulate its activity and affect cellular processes such as transcription and DNA repair. The RBBP7 antibody can be used in assays to study the expression and localization of RBBP7 in different cell types or tissues. Additionally, it has potential therapeutic applications as a medicament for diseases involving abnormal RBBP7 function. With its high specificity and affinity, the RBBP7 antibody is a valuable tool for researchers in the field of Life Sciences and offers promising opportunities for the development of targeted therapies and chemotherapy.Claudin Domain Containing 1 antibody
Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLDegré de pureté :Min. 95%SPINT1 antibody
SPINT1 antibody was raised in rabbit using the C terminal of SPINT1 as the immunogenDegré de pureté :Min. 95%Factor XIIIA antibody
Factor XIIIA antibody is a monoclonal antibody used in the field of Life Sciences. It has antiviral properties and specifically targets carbonic molecules. This antibody can be used in various applications such as electrode development, colloidal chemistry, and chemokine research. Additionally, it has been proven effective in human serum electrophoresis studies, where it showed high affinity for alpha-fetoprotein and glycoproteins. Factor XIIIA antibody also exhibits natriuretic properties by targeting brain natriuretic peptide. With its specificity and versatility, this monoclonal antibody is an essential tool for researchers in the field of Life Sciences.NUP98 antibody
NUP98 antibody was raised in rabbit using the N terminal of NUP98 as the immunogenDegré de pureté :Min. 95%Human IgE protein
Human IgE protein is an important component of the immune system and plays a crucial role in allergic reactions. It is an immunoglobulin that binds to specific allergens, triggering the release of histamine and other inflammatory substances. Human IgE protein can be used in various applications, including research, diagnostics, and therapeutic interventions. Interferon is a type of cytokine that regulates the immune response against viral infections. Monoclonal antibodies are laboratory-produced molecules that can mimic the immune system's ability to fight off harmful pathogens. Autoantibodies are antibodies produced by the immune system that mistakenly target and attack healthy cells or tissues. Antiphospholipid antibodies are a type of autoantibody that targets phospholipids, leading to an increased risk of blood clots. Fatty acids are essential nutrients that play a crucial role in various physiological processes. Heparin-induced thrombocytopenia is a condition characterized by a decrease in platelet count due to an immuneDegré de pureté :>95% By Sds-PageSLC19A3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC19A3 antibody, catalog no. 70R-7535
Degré de pureté :Min. 95%LSS antibody
LSS antibody was raised using a synthetic peptide corresponding to a region with amino acids TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLRabbit anti Mouse IgG2a (biotin)
Rabbit anti-mouse IgG2a (biotin) was raised in rabbit using murine IgG2a heavy chain as the immunogen.Degré de pureté :Min. 95%PCDHA3 antibody
PCDHA3 antibody was raised using the N terminal of PCDHA3 corresponding to a region with amino acids LFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQDDegré de pureté :Min. 95%FGFR1 antibody
The FGFR1 antibody is a highly specific monoclonal antibody that targets the FGFR1 protein, a key molecule involved in various cellular processes. This antibody recognizes specific amino acid residues on the FGFR1 protein and binds to it with high affinity. By binding to FGFR1, this antibody inhibits its activity and disrupts downstream signaling pathways.KCNQ2 antibody
KCNQ2 antibody was raised using the N terminal of KCNQ2 corresponding to a region with amino acids IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLDegré de pureté :Min. 95%PCOLCE antibody
PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKSDegré de pureté :Min. 95%beta 2 Microglobulin antibody
Beta 2 microglobulin antibody was raised in rabbit using beta-2-microglobulin from human Urine as the immunogen.Degré de pureté :Min. 95%MAT2A antibody
MAT2A antibody was raised using the middle region of MAT2A corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKRb antibody
The Rb antibody is a monoclonal antibody that specifically targets and binds to the Rb protein. This antibody is widely used in various assays and research applications in the field of Life Sciences. It has been extensively validated for use in nuclear staining, immunohistochemistry, and Western blotting. The Rb antibody offers high sensitivity and specificity, making it an ideal tool for studying the expression and localization of Rb protein in different tissues and cell types. Additionally, this antibody has been successfully used in studies involving human serum markers such as histamine, erythropoietin, sclerostin, glp-1, and human chorionic gonadotropin. With its superior performance and reliability, the Rb antibody is a valuable asset for researchers looking to unravel the intricate mechanisms underlying various biological processes.Degré de pureté :Min. 95%TAU antibody
The TAU antibody is a highly specialized monoclonal antibody that targets the growth factor known as acetylcholine. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It specifically binds to interferon-gamma (IFN-gamma) and inhibits its activity, leading to a decrease in the production of chemokines and other inflammatory mediators.DBH antibody
The DBH antibody is a glycopeptide that belongs to the class of polyclonal antibodies. It specifically targets and binds to the glycoprotein known as dopamine beta-hydroxylase (DBH). DBH is an enzyme that plays a crucial role in the conversion of dopamine to norepinephrine, making it essential for proper neurotransmitter function.
FKBP1A protein
The FKBP1A protein is a versatile and important component in various biochemical processes. It can be used in research, diagnostics, and therapeutic applications. This protein has been extensively studied and characterized for its role in protein folding, cellular signaling, and immune response regulation.Degré de pureté :Min. 95%Mafk antibody
Mafk antibody was raised in rabbit using the N terminal of Mafk as the immunogenDegré de pureté :Min. 95%CISD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CISD2 antibody, catalog no. 70R-6583Degré de pureté :Min. 95%14-3-3 zeta antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it possesses strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.
Degré de pureté :Min. 95%PRRC1 antibody
PRRC1 antibody was raised using the middle region of PRRC1 corresponding to a region with amino acids VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIATRIM27 antibody
TRIM27 antibody was raised in rabbit using the middle region of TRIM27 as the immunogenDegré de pureté :Min. 95%Chk1 antibody
The Chk1 antibody is a powerful tool in the field of molecular biology and research. This antibody specifically targets and binds to the Chk1 protein, which plays a crucial role in cell cycle regulation and DNA damage response. By inhibiting the activity of Chk1, this antibody can be used to study the effects of Chk1 inhibition on various cellular processes.Degré de pureté :Min. 95%CHN2 antibody
CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK
RAB38 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB38 antibody, catalog no. 70R-5865
Degré de pureté :Min. 95%
