Produits biochimiques et réactifs
Les biochimiques et réactifs sont des substances fondamentales pour la recherche et le développement dans des domaines tels que la biotechnologie, la biologie moléculaire, la pharmacologie et la médecine. Ces produits sont essentiels pour une variété d'applications, y compris la synthèse de composés, l'analyse d'échantillons biologiques, la recherche sur les processus métaboliques et la production de médicaments. Chez CymitQuimica, nous proposons une large sélection de biochimiques et réactifs de haute qualité et pureté, adaptés à divers besoins scientifiques et industriels. Notre catalogue comprend des enzymes, des anticorps, des acides nucléiques, des acides aminés et de nombreux autres produits, tous conçus pour soutenir les chercheurs et les professionnels dans leurs projets de recherche et développement, garantissant des résultats fiables et reproductibles.
Sous-catégories appartenant à la catégorie "Produits biochimiques et réactifs"
- Biomolécules(98.570 produits)
- Par Biological Target(100.766 produits)
- Par usage/effets pharmacologiques(6.938 produits)
- Cryoconservation et composés associés aux cryoconservateurs(21 produits)
- Désinfectants, additifs pour les fluides pour bains chauffants et composés apparentés(28 produits)
- Hormones(477 produits)
- Biologie végétale(6.906 produits)
- Métabolites secondaires(14.368 produits)
130507 produits trouvés pour "Produits biochimiques et réactifs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
CANX antibody
CANX antibody was raised in rabbit using the middle region of CANX as the immunogenDegré de pureté :Min. 95%NGAL antibody
The NGAL antibody is a monoclonal antibody used in Life Sciences research. It is commonly used in immunoassays to detect and quantify NGAL (Neutrophil Gelatinase-Associated Lipocalin) levels in human serum. This antibody has high specificity and sensitivity, making it ideal for accurate and reliable measurements. The NGAL antibody can also be used in assays to detect autoantibodies or anti-drug antibodies. It is buffered and stable, ensuring consistent performance in various experimental conditions. Additionally, this antibody can be conjugated with different markers such as carbon quantum dots or colloidal gold for visualization purposes. Whether you are studying kidney diseases, inflammation, or drug development, the NGAL antibody is an essential tool for your research needs.Pfkfb2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Pfkfb2 antibody, catalog no. 70R-9421
Degré de pureté :Min. 95%PHF12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PHF12 antibody, catalog no. 70R-8895Degré de pureté :Min. 95%ANKRD11 antibody
ANKRD11 antibody was raised using the N terminal of ANKRD11 corresponding to a region with amino acids KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIRLaminin γ 1 antibody
The Laminin Gamma 1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the laminin gamma 1 protein, which plays a crucial role in cell adhesion and migration. By blocking the activity of this protein, the antibody can inhibit the formation of new blood vessels, known as microvessel density, which is essential for tumor growth and metastasis. Additionally, this antibody has been shown to activate phosphatase enzymes, which are involved in regulating cellular processes such as signal transduction and gene expression. The Laminin Gamma 1 antibody can be used in various applications, including immunohistochemistry and Western blotting, to study the role of laminin gamma 1 in different biological systems. Researchers can also use this antibody to investigate potential therapeutic targets for diseases involving abnormal angiogenesis or aberrant cell adhesion.RBBP6 antibody
RBBP6 antibody was raised using the N terminal of RBBP6 corresponding to a region with amino acids APPVSGNPSSAPAPVPDITATVSISVHSEKSDGPFRDSDNKILPAAALAS
Degré de pureté :Min. 95%Goat anti Rat IgG (H + L) (R-PE)
Goat anti Rat IgG (H + L) (R-PE) secondary antibodyDegré de pureté :Min. 95%Goat anti Human IgG + IgA + IgM (rhodamine)
This antibody reacts with kappa light chains on human immunoglobulins.
Degré de pureté :Min. 95%Nucleobindin 1 antibody
Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHLDegré de pureté :Min. 95%Rabbit anti Goat IgG (rhodamine)
Rabbit anti-goat IgG (Rhodamine) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.Degré de pureté :Min. 95%FSTL5 antibody
FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids EAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMECHDC2 antibody
ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI
Degré de pureté :Min. 95%AGPAT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AGPAT2 antibody, catalog no. 70R-1770Degré de pureté :Min. 95%NETO1 antibody
NETO1 antibody was raised in rabbit using the C terminal of NETO1 as the immunogen
Degré de pureté :Min. 95%UMOD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UMOD antibody, catalog no. 70R-8504
Degré de pureté :Min. 95%ANXA8L2 protein (His tag)
Purified recombinant Human ANXA8L2 Protein (His tag)Degré de pureté :Min. 95%MDC protein (Mouse)
Region of MDC protein corresponding to amino acids GPYGANVEDS ICCQDYIRHP LPSRLVKEFF WTSKSCRKPG VVLITVKNRD ICADPRQVWV KKLLHKLS.
Degré de pureté :Min. 95%USP53 antibody
The USP53 antibody is a powerful tool used in the field of Life Sciences for research purposes. It is an antibody that specifically targets and binds to the USP53 protein, which is involved in various cellular processes such as DNA repair and cell cycle regulation. This antibody can be used in experiments to study the expression and localization of USP53 in different cell types and tissues. It can also be utilized to investigate the role of USP53 in disease development and progression.STOML1 antibody
The STOML1 antibody is a powerful tool in the field of Life Sciences. It specifically targets the molecular target known as STOML1, which plays a crucial role in various biological processes. This antibody is widely used in basic research and has proven to be highly effective in immunohistochemistry experiments. By inhibiting the activity of STOML1, this polyclonal antibody allows researchers to gain valuable insights into the function and regulation of this important protein. With its high specificity and sensitivity, the STOML1 antibody is an essential tool for scientists working in a wide range of disciplines.Goat anti Mouse IgG + IgM (H + L) (FITC)
Goat anti-mouse IgG/IgM (H+L) (FITC) was raised in goat using murine IgG and IgM whole molecules as the immunogen.Degré de pureté :Min. 95%Dkk1 protein (His tag)
32-266 amino acids: ADPTLNSVLN SNAIKNLPPP LGGAAGHPGS AVSAAPGILY PGGNKYQTID NYQPYPCAED EECGTDEYCA SPTRGGDAGV QICLACRKRR KRCMRHAMCC PGNYCKNGIC VSSDQNHFRG EIEETITESF GNDHSTLDGY SRRTTLSSKM YHTKGQEGSV CLRSSDCASG LCCARHFWSK ICKPVLKEGQ VCTKHRRKGS HGLEIFQRCY CGEGLSCRIQ KDHHQASNSS RLHTCQRHSG RLVPRGSHHH HHHDegré de pureté :Min. 95%PCI antibody (HRP)
PCI antibody (HRP) was raised in goat using human Protein C Inhibitor purified from plasma as the immunogen.STAMBP antibody
STAMBP antibody was raised using the N terminal of STAMBP corresponding to a region with amino acids SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSDegré de pureté :Min. 95%Factor X antibody
Factor X antibody was raised in goat using human Factor X purified from plasma as the immunogen.
THOC6 antibody
THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVRTIGAR antibody
The TIGAR antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and neutralizes the activity of cholesterol esterase, an enzyme involved in cholesterol metabolism. This antibody has been shown to inhibit the growth factor signaling pathway and induce cytotoxic effects in various cell types. The recombinant antigen used to generate this antibody is derived from interferon-treated cells, ensuring high specificity and sensitivity. In addition to its role as a cholesterol esterase inhibitor, the TIGAR antibody has also been used as a cdk4/6 inhibitor in cancer research. Polyclonal Antibodies generated against this target have been successfully used for chemical synthesis and detection of cholesterol oxidase in human serum samples. With its versatile applications and reliable performance, the TIGAR antibody is a valuable tool for researchers working with microvessel endothelial cells or studying cholesterol metabolism pathways.PRPF19 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRPF19 antibody, catalog no. 70R-1048Degré de pureté :Min. 95%mTOR antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and acts as a bactericidal agent. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth. Experience the powerful effects of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment against tuberculosis.
