Produits biochimiques et réactifs

<p>CAMK1D antibody was raised in Rabbit using Human CAMK1D as the immunogen</p>

Penicillin antibody was raised in mouse using penicillin as the immunogen.

Sheep polyclonal Nicarbazin antibody

<p>SERPINI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF</p>

<p>BMX-IN-1 is a DNA polymerase inhibitor that has been used in the study of chemical biology. It has been shown to selectively inhibit transcription and replication of pro-inflammatory cytokines, such as tumor necrosis factor-α (TNF-α). The kinetics of BMX-IN-1 have been studied by measuring the inhibition of transcription in vitro. The optimum concentration for BMX-IN-1 was found to be 0.3 μM, which inhibits the synthesis of TNF-α by 58%. BMX-IN-1 also inhibits cancer tissue growth and may be an effective treatment for cancer. This drug is a potential molecular target for cervical cancer.</p>

<p>alpha Tubulin 4A antibody was raised using the middle region of TUBA4A corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH</p>

Purified recombinant MLLT11 protein (His tag)

WNT7B antibody was raised using the middle region of WNT7B corresponding to a region with amino acids WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

<p>Rabbit polyclonal URM1 antibody</p>

Mouse monoclonal POLR2E antibody

<p>DPF1 antibody was raised in rabbit using the middle region of DPF1 as the immunogen</p>

Rabbit polyclonal SAMD4A antibody

<p>Purified Polyclonal ZO3 antibody</p>

VZV gpl antibody was raised in mouse using varicella zoster virus HZ strain as the immunogen.

IL2 antibody was raised in Mouse using recombinant human IL-2 as the immunogen.

<p>ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL</p>

<p>Rabbit Polyclonal GRK2 antibody (Ser29)</p>

<p>Goat anti-Mouse IgG + IgM (HRP) was raised in goat using purified Mouse IgG + IgM as the immunogen.</p>

<p>Rabbit polyclonal BTF3L3 antibody</p>

<p>Rabbit polyclonal MNK1 antibody</p>

<p>RC3H2 antibody was raised using the middle region of RC3H2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR</p>

ALS2CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP

<p>Mouse monoclonal DNTTIP1 antibody</p>

<p>VU 0361737 is a small molecule that has been shown to have anti-inflammatory properties. It binds to glutamate receptors, which are involved in the regulation of inflammatory responses and pain. VU 0361737 also blocks microglia activation, prevents glutamate toxicity, and inhibits tumor progression in a mouse model of melanoma. It was also found to be neuroprotective against glutamate-induced neurotoxicity in primary hippocampal neurons and cerebellar granule cells. The molecular mode of action of VU 0361737 is not completely understood, but it may be due to its ability to block the adenosine receptor A2A signaling pathway.</p>

<p>Rabbit polyclonal XPNPEP3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive studies have shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

IL1b antibody is a monoclonal antibody that specifically targets and neutralizes interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various biological processes. IL-1β plays a crucial role in the regulation of immune responses, cell growth, and differentiation. This antibody has been extensively used in research and life sciences to study the function of IL-1β and its inhibitors.

SRD5A2 antibody was raised using the N terminal of SRD5A2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR

<p>The CDK5 antibody is a highly specialized monoclonal antibody that has neutralizing properties against cyclin-dependent kinase 5 (CDK5). CDK5 is an enzyme involved in various cellular processes, including cell cycle regulation and neuronal development. The CDK5 antibody acts as an inhibitor of CDK5 activity, leading to cytotoxic effects on targeted cells.</p>

HMN-176 is a synthetic antifungal compound, which is an indolocarbazole derivative sourced from a natural alkaloid framework. This product exhibits its mode of action by inhibiting fungal cell division, specifically through interference with microtubule polymerization. This mechanism effectively disrupts the mitotic process, leading to cell cycle arrest and subsequent fungal cell death.

<p>Recombinant Human RPL7A protein</p>

<p>Mouse monoclonal NME4 antibody</p>

The Cytokeratin Antibody Cocktail is a powerful tool for immunohistochemistry and research applications. This cocktail contains a mixture of monoclonal antibodies that specifically target various cytokeratins, which are intermediate filament proteins found in epithelial cells. These monoclonal antibodies have been extensively validated and provide high specificity and sensitivity in detecting cytokeratin expression.

<p>Purified recombinant MDS1 protein (His tag)</p>

<p>Mouse monoclonal Complement D antibody</p>

Rabbit polyclonal ZNF699 antibody

TMTC4 antibody was raised using the N terminal of TMTC4 corresponding to a region with amino acids NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF

<p>Purified recombinant KLF7 protein (His tag)</p>

<p>The TIMM10 antibody is a polyclonal antibody that specifically targets the TIMM10 protein. This protein is located in the mitochondria and plays a crucial role in various cellular processes, including hormone and growth factor signaling, as well as β-catenin stabilization. The TIMM10 antibody binds to the amino-terminal region of the protein, allowing for its detection and analysis in biological samples.</p>

Trazodone Conjugate for use in immunoassays

Mouse monoclonal TOMM34 antibody

Purified recombinant MFAP4 protein (His tag)

PAX6 antibody was raised in Mouse using a purified recombinant fragment of human PAX6 expressed in E. coli as the immunogen.

B3GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY

<p>Rabbit polyclonal M2A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been confirmed through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth. With its multifaceted mechanism of action and proven efficacy, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an invaluable tool in the fight against tuberculosis.</p>

Mouse monoclonal IFI35 antibody

<p>Transferrin protein is a versatile monoclonal antibody that has various applications in the field of life sciences. It plays a crucial role in cell growth and development by binding to specific molecules and promoting cellular processes. Transferrin protein is commonly used as a carrier for targeted drug delivery, especially in combination with trastuzumab, an anti-HER2 antibody. The protein contains an amino group that can be conjugated with different molecules, such as fatty acids or other monoclonal antibodies, to enhance its functionality.</p>

<p>CCNB1IP1 antibody was raised in mouse using recombinant Human Cyclin B1 Interacting Protein 1 (Ccnb1Ip1)</p>

<p>PDGFRalpha kinase inhibitor 1 is an inhibitor of the PDGFRalpha protein. The PDGFRalpha protein is a receptor tyrosine kinase that belongs to the group of receptors that are activated by specific growth factors and cytokines. This inhibitor has affinity for the active site of PDGFRalpha, where it binds and blocks the catalytic activity of this enzyme.<br>PDGFRalpha kinase inhibitor 1 is a potent, selective and reversible inhibitor of PDGFRα with IC50 value in low micromolar range. It does not inhibit other tyrosine kinases such as PDGFRA, AXL, RET or KIT.</p>