Produits biochimiques et réactifs

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFM2 antibody, catalog no. 70R-10104</p>

<p>1-181 amino acids: MGSSHHHHHH SSGLVPRGSH MESKEPQLKG IVTRLFSQQG YFLQMHPDGT IDGTKDENSD YTLFNLIPVG LRVVAIQGVK ASLYVAMNGE GYLYSSDVFT PECKFKESVF ENYYVIYSST LYRQQESGRA WFLGLNKEGQ IMKGNRVKKT KPSSHFVPKP IEVCMYREQS LHEIGEKQGR SRKSSGTPTM NGGKVVNQDS T</p>

<p>The CD10 antibody is a monoclonal antibody that targets the CD10 protein, which is also known as neutral endopeptidase. This protein plays a crucial role in the degradation of extracellular matrix components such as collagen and acts as a kinase inhibitor. The CD10 antibody has been widely used in Life Sciences research to study various biological processes.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The SYNCRIP antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. This antibody has been extensively tested and shown to be effective in detecting SYNCRIP proteins in human serum samples.</p>

<p>MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK</p>

<p>REEP1 antibody was raised using the middle region of REEP1 corresponding to a region with amino acids AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI</p>

<p>The GPR87 antibody is a highly effective polyclonal antibody that specifically targets G-protein coupled receptor 87 (GPR87). This antibody has the ability to neutralize the activity of GPR87, which is known to play a crucial role in various cellular processes. It has been shown to inhibit the epidermal growth factor (EGF) signaling pathway, making it an excellent candidate for therapeutic applications in cancer treatment. Additionally, this antibody has shown promising results as a potential anti-HER2 antibody, further highlighting its versatility and effectiveness. With its ability to bind to interferon-gamma (IFN-gamma) and other growth factors, the GPR87 antibody offers a wide range of applications in the field of life sciences. Whether used as a research tool or for therapeutic purposes, this antibody is a valuable asset for scientists and researchers alike.</p>

<p>Purified Rabbit polyclonal MRPL50 antibody</p>

N-[3-[(2R,3R)-5-Amino-3,6-dihydro-3-methyl-2-(trifluoromethyl)-2H-1,4-oxazin-3-yl]-4-fluorophenyl]-5-cyano-2-pyridinecarboxamide is a high purity chemical compound that is used in research. CAS No. 1352416-78-4 is an antibody that binds to the receptor of the ion channels and can be used as a research tool. The ligand is an inhibitor or activator of the protein interactions. This reagent has been shown to be useful for the study of cell biology and pharmacology.

<p>OXCT1 antibody was raised using the N terminal of OXCT1 corresponding to a region with amino acids TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV</p>

<p>Rabbit polyclonal USP34 antibody</p>

<p>RAB27A antibody was raised using the middle region of RAB27A corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NKAIN1 antibody, catalog no. 70R-7160</p>

<p>The C1S antibody is a potent monoclonal antibody that belongs to the class of neutralizing antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets and neutralizes C1S, a protease involved in the complement system. By inhibiting C1S activity, this antibody can modulate immune responses and prevent excessive inflammation. Additionally, this monoclonal antibody has been shown to have mitogenic properties, stimulating cell growth and proliferation in various cell types such as dopamine-producing cells and collagen-producing cells. Furthermore, it has been used in research studies to enhance the oncolytic activity of adenoviruses and inhibit protease activity at low pH levels. The C1S antibody is a valuable tool for researchers studying hepatocyte growth and activation pathways.</p>

<p>Mouse monoclonal KIAA1609 antibody</p>

<p>Mouse monoclonal SPG7 antibody</p>

<p>Rabbit polyclonal LATS2 antibody</p>

<p>Rabbit polyclonal Adiponectin antibody (HRP)</p>

<p>VSV-G antibody was raised in goat using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.</p>

<p>Purified Polyclonal cJun antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound used as an antituberculosis drug. It belongs to the class of rifamycins and is highly effective in treating tuberculosis infections. This drug works by inhibiting bacterial growth through its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, thus stopping the spread of the infection. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations in the body, ensuring its effectiveness against the bacteria.</p>

<p>MRPS22 antibody was raised in Rabbit using Human MRPS22 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK5 antibody, catalog no. 70R-5224</p>

<p>FBXO11 antibody was raised using the middle region of FBXO11 corresponding to a region with amino acids HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ</p>

<p>Purified recombinant STEAP4 protein (His tag)</p>

<p>UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK</p>

<p>Rabbit polyclonal UNC45A antibody</p>

<p>The Cytokeratin 8 antibody is a recombinant monoclonal antibody that serves as a diagnostic reagent for various applications. It is specifically designed to target cytokeratin 8, a protein found in liver microsomes and human serum. This antibody can be used in immunohistochemistry, Western blotting, and other techniques for the detection and analysis of cytokeratin 8 expression.</p>

<p>SLC10A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP</p>

<p>Mouse monoclonal RPTP antibody</p>

<p>STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL</p>

<p>PML antibody was raised in rabbit using the C terminal of PML as the immunogen</p>

<p>EIF4E antibody was raised using the C terminal of EIF4E corresponding to a region with amino acids TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV</p>

<p>Purified recombinant ID2 protein (His tag)</p>

<p>Mouse monoclonal FOXO1 antibody (C-terminus)</p>

<p>alpha 1 Antiplasmin Matched Pair antibody Set for ELISA</p>

<p>ND5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM</p>

<p>The MSH6 antibody is a powerful tool used in life sciences research. It belongs to the family of polyclonal antibodies and has neutralizing properties. This antibody specifically targets the protein MSH6, which plays a crucial role in DNA repair and maintenance of genomic stability. By binding to MSH6, this antibody inhibits its activity and prevents it from interacting with other proteins involved in DNA repair processes.</p>

<p>ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV</p>

<p>Rat monoclonal B7H4 antibody (PE)</p>

<p>Purified Polyclonal MCT13 antibody</p>

Rabbit polyclonal SPATA7 antibody

<p>Purified Rabbit polyclonal CEP78 antibody</p>

<p>KYNU antibody was raised in Rabbit using Human KYNU as the immunogen</p>

<p>FAM92B antibody was raised using the N terminal of FAM92B corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH</p>

<p>Rabbit polyclonal SDF4 antibody</p>

<p>Purified recombinant Dengue NS1 protein (Serotype 1) (His tag)</p>

<p>TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA</p>

<p>The LY6E antibody is a highly activated monoclonal antibody that belongs to the class of anti-CD20 antibodies. It is commonly used in Life Sciences research for its ability to target and bind to specific proteins, such as glucose transporters and protein kinases, which play crucial roles in various cellular processes. The LY6E antibody has been shown to exhibit cytotoxic effects on targeted cells, leading to their destruction. Additionally, it has been found to interact with mitogen-activated protein (MAP) pathways and nuclear tyrosine residues, further enhancing its therapeutic potential. This antibody has also demonstrated promising results in inhibiting the activity of alpha-synuclein, a protein associated with neurodegenerative disorders like Parkinson's disease. Moreover, the LY6E antibody has shown excellent stability and specificity when tested in human serum samples. With its diverse applications and impressive performance, this antibody is a valuable tool for researchers in fields such as immunology, oncology, and neuroscience.</p>