Produits biochimiques et réactifs

<p>Purified recombinant CXCL16 protein (Mouse) (His tag)</p>

Purified native Human TBG protein

<p>The EPN3 antibody is a highly potent and cytotoxic recombinant antigen that belongs to the class of antibodies used in Life Sciences. Specifically, it targets insulin and its related growth factors. This antibody has been extensively studied and shown to have neutralizing effects on insulin activity. It binds to specific epitopes on insulin molecules, preventing their interaction with receptors and inhibiting downstream signaling pathways.</p>

<p>SEMA6A antibody was raised using the middle region of SEMA6A corresponding to a region with amino acids ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR</p>

<p>Rabbit polyclonal RapGEF1 antibody (Tyr504)</p>

<p>Rabbit polyclonal SNAPIN antibody</p>

<p>The p47 phox antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the p47 phox protein, which plays a crucial role in the activation of macrophages. This antibody can be used to study the function and regulation of p47 phox in various biological processes.</p>

<p>The LILRB4 antibody is a monoclonal antibody that specifically targets the LILRB4 protein. This protein is known to play a role in immune regulation and has been found to be involved in various diseases, including cancer and autoimmune disorders. The LILRB4 antibody works by neutralizing the activity of the LILRB4 protein, thereby modulating immune responses.</p>

<p>Purified recombinant TNFRSF11A protein (His tag)</p>

<p>Recombinant Mouse IL33 protein</p>

<p>The TGFBR2 antibody is a polyclonal antibody that specifically targets the growth factor receptor known as TGFBR2. This antibody has been extensively studied and has shown promising results in various applications. It has been used in combination with other antibodies, such as trastuzumab, to enhance the cytotoxic effects against cancer cells. Additionally, the TGFBR2 antibody has been used to detect and quantify specific antibodies, including anti-ACTH antibodies, in various samples. It has also been utilized in research studies involving mycoplasma genitalium and collagen inhibitors. The TGFBR2 antibody is a valuable tool for researchers studying EGF-like growth factors, TGF-beta signaling pathways, chemokines, and other related areas of study. With its high specificity and neutralizing capabilities, this monoclonal antibody is an essential asset for any researcher in need of reliable and accurate results.</p>

<p>ApoA-I protein is a collagen-like protein that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. This native protein can be targeted with monoclonal antibodies to detect autoantibodies or used as a control in experiments. ApoA-I protein contains amide groups, which are important for its structure and function. It interacts with phosphatases, growth factors, and endothelial growth inhibitors to regulate endothelial cell proliferation. Additionally, it can activate tyrosine kinase receptors, leading to downstream signaling pathways. ApoA-I protein is widely used in life sciences research for studying cardiovascular diseases, lipid metabolism, and other related fields.</p>

<p>The RXRB antibody is a highly specialized antibody that targets the RXR-beta protein, which is a cation channel and methyl transferase found in the nucleus of cells. This antibody is widely used in various research fields, including life sciences and medicine. It can be used in assays to detect the presence of RXR-beta protein or to study its function in different cellular processes.</p>

<p>Mouse monoclonal anti human BMP8b antibody</p>

<p>NUP155 antibody was raised using the middle region of NUP155 corresponding to a region with amino acids ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY</p>

DHRS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLL

<p>MMP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA</p>

<p>Rabbit polyclonal OR5H1 antibody</p>

<p>alpha Actinin 3 antibody was raised using the N terminal of ACTN3 corresponding to a region with amino acids  VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY</p>

<p>Rabbit polyclonal IFNGR antibody (Tyr457)</p>

<p>The RAD51 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the RAD51 protein, which plays a crucial role in DNA repair and recombination. This antibody has been extensively tested and validated for use in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.</p>

<p>HS1BP3 antibody was raised in Rabbit using Human HS1BP3 as the immunogen</p>

<p>Rat monoclonal CD93 antibody (allophycocyanin)</p>

<p>SLCO1A2 antibody was raised using the middle region of SLCO1A2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of JARID2 antibody, catalog no. 70R-5246</p>

<p>GTF2A1 antibody was raised in mouse using recombinant Human General Transcription Factor Iia, 1, 19/37Kda (Gtf2A1)</p>

<p>Mouse monoclonal DOK2 antibody</p>

<p>The ID1 antibody is a powerful tool in the field of Life Sciences. It is a neutralizing antibody that targets TGF-β1, a key protein involved in various cellular processes. This antibody can effectively block the activity of TGF-β1, preventing its interaction with receptors and downstream signaling pathways. Additionally, the ID1 antibody has been shown to inhibit the binding of TGF-β1 to fibrinogen, further highlighting its potential therapeutic applications.</p>

<p>CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV</p>

<p>NFKBIA antibody was raised in mouse using recombinant Nuclear Factor Of Kappa Light Polypeptide Gene Enhancer In B-Cells Inhibitor</p>

<p>The Cortactin antibody is a highly specialized antibody that plays a crucial role in various life sciences research applications. This antibody specifically targets the protein known as Cortactin, which is a key regulator of actin cytoskeleton dynamics.</p>

<p>Rabbit polyclonal NDUFV2 antibody (HRP)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>APRIN antibody was raised in mouse using recombinant Human Pds5, Regulator Of Cohesion Maintenance, Homolog B (S.Cerevisiae) (Pds5B)</p>

<p>Rabbit polyclonal ZC3HC1 antibody</p>

Purified recombinant HP protein (His tag)

<p>Rabbit Polyclonal CSFR antibody (Tyr809)</p>

<p>AURKB antibody was raised in mouse using recombinant human Aurora kinase B (1-344aa) purified from E. Coli as the immunogen.</p>

<p>Purified recombinant PHB2 protein (His tag)</p>

<p>CA2 antibody was raised in rabbit using the C terminal of CA2 as the immunogen</p>

<p>PPOX antibody was raised using the N terminal of PPOX corresponding to a region with amino acids SSERLGGWIRSVRGPNGAIFELGPRGIRPAGALGARTLLLVSELGLDSEV</p>

<p>The CD49e antibody is a powerful inhibitor that targets the beta-hairpin region of specific proteins. It has been extensively used in research studies in the field of Life Sciences, particularly in the area of Monoclonal Antibodies. This antibody exhibits cytotoxic effects and can also act as an agonist, stimulating specific cellular responses. The CD49e antibody has shown significant potential in blocking nuclear growth factors and inhibiting angiogenesis by targeting VEGF (vascular endothelial growth factor). Additionally, it has been found to have an impact on various signaling pathways, including c-myc and erythropoietin. Moreover, this antibody demonstrates antioxidant properties by reducing superoxide levels and enhancing insulin sensitivity. With its multifaceted characteristics, the CD49e antibody offers exciting opportunities for further exploration and application in biomedical research.</p>

<p>Mouse monoclonal Ig lambda light chain antibody (PE)</p>

<p>Mouse monoclonal CCM2 antibody</p>

<p>The N Cadherin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to N Cadherin, a protein involved in cell-cell adhesion. This antibody has been extensively tested and validated for various applications, including immunohistochemistry, Western blotting, flow cytometry, and ELISA.</p>

<p>Purified Rabbit polyclonal MBTPS2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes.</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTCH1 antibody, catalog no. 70R-6354</p>